Recombinant Human FECH Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FECH-1007H |
Product Overview : | FECH MS Standard C13 and N15-labeled recombinant protein (NP_001012533) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is localized to the mitochondrion, where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Mutations in this gene are associated with erythropoietic protoporphyria. Two transcript variants encoding different isoforms have been found for this gene. A pseudogene of this gene is found on chromosome 3. |
Molecular Mass : | 48.63 kDa |
AA Sequence : | MRSLGANMAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETAQHAQGAKPQVQPQKRYESNIRKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FECH ferrochelatase [ Homo sapiens (human) ] |
Official Symbol | FECH |
Synonyms | FECH; ferrochelatase; ferrochelatase (protoporphyria); ferrochelatase, mitochondrial; protoporphyria; heme synthase; heme synthetase; protoheme ferro-lyase; EPP; FCE; |
Gene ID | 2235 |
mRNA Refseq | NM_001012515 |
Protein Refseq | NP_001012533 |
MIM | 612386 |
UniProt ID | P22830 |
◆ Recombinant Proteins | ||
FECH-5770C | Recombinant Chicken FECH | +Inquiry |
FECH-2899B | Recombinant Bovine FECH protein, His-SUMO & Myc-tagged | +Inquiry |
FECH-905H | Recombinant Human FECH Protein, His (Fc)-Avi-tagged | +Inquiry |
FECH-12837H | Recombinant Human FECH protein, His-tagged | +Inquiry |
Fech-2984M | Recombinant Mouse Fech Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FECH-6267HCL | Recombinant Human FECH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FECH Products
Required fields are marked with *
My Review for All FECH Products
Required fields are marked with *