Recombinant Human FGF1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FGF1-5960H
• Product Overview: FGF1 MS Standard C13 and N15-labeled recombinant protein (NP_000791) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described.
• Molecular Mass: 17.5 kDa
• AA Sequence: MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FGF1 fibroblast growth factor 1 [ Homo sapiens (human) ]
• Official Symbol: FGF1
• Synonyms: FGF1; fibroblast growth factor 1 (acidic); FGFA; fibroblast growth factor 1; AFGF; ECGF; ECGF beta; ECGFA; ECGFB; endothelial cell growth factor; alpha; beta; FGF alpha; GLIO703; HBGF1; heparin binding growth factor 1; heparin-binding growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, beta; endothelial cell growth factor, alpha; FGF-1; HBGF-1; ECGF-beta; FGF-alpha
• Gene ID: 2246
• mRNA Refseq: NM_000800
• Protein Refseq: NP_000791
• MIM: 131220
• UniProt ID: P05230