Active Recombinant Human FGF1 Protein (Carry Free-Ready-To-Use, 140 amino acid)
Cat.No. : | FGF1-10H |
Product Overview : | Recombinant Human FGF1 Protein (Carry Free-Ready-To-Use) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 140 amino acid |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. |
Bio-activity : | ED50 < 0.1 ng/mL as determined by its ability to the dose dependent proliferation of mouse Balb/c 3T3 cells. |
Molecular Mass : | 15.8 kDa |
AA Sequence : | FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
Endotoxin : | < 1.0 EU/μg of protein as determined by the LAL assay |
Purity : | > 98% by SDS-PAGE |
Storage : | It is stable for up to 6 months from date of receipt when stored at -80 centigrade. Multiple freeze/thaw cycles should be avoided as it can result in significant loss of activity. |
Storage Buffer : | Sterile filtered through a 0.2 micron filter in 1xPBS, 1.5 M NaCl. |
Shipping : | This product is shipped on dry ice. |
Gene Name | FGF1 fibroblast growth factor 1 [ Homo sapiens (human) ] |
Official Symbol | FGF1 |
Synonyms | FGF1; fibroblast growth factor 1; AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha; fibroblast growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, alpha; endothelial cell growth factor, beta; fibroblast growth factor 1 (acidic); heparin-binding growth factor 1 |
Gene ID | 2246 |
mRNA Refseq | NM_000800 |
Protein Refseq | NP_000791 |
MIM | 131220 |
UniProt ID | P05230 |
◆ Recombinant Proteins | ||
Fgf1-10M | Recombinant Mouse Fibroblast Growth Factor-acidic | +Inquiry |
Fgf1-403F | Active Recombinant Mouse Fgf1 Protein (140 aa) | +Inquiry |
FGF1-79M | Recombinant Mouse/Rat FGF1 Protein | +Inquiry |
FGF1-043H | Active Recombinant Human FGF1 Protein | +Inquiry |
FGF1-10H | Active Recombinant Human FGF1 Protein (Carry Free-Ready-To-Use, 140 amino acid) | +Inquiry |
◆ Native Proteins | ||
FGF1-33B | Active Native Bovine FGF1 | +Inquiry |
FGF1-26203TH | Native Human FGF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF1-6252HCL | Recombinant Human FGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF1 Products
Required fields are marked with *
My Review for All FGF1 Products
Required fields are marked with *
0
Inquiry Basket