Recombinant Human FGF19 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FGF19-3206H |
Product Overview : | FGF19 MS Standard C13 and N15-labeled recombinant protein (NP_005108) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This growth factor is a high affinity, heparin dependent ligand for FGFR4. Expression of this gene was detected only in fetal but not adult brain tissue. Synergistic interaction of the chick homolog and Wnt-8c has been shown to be required for initiation of inner ear development. |
Molecular Mass : | 24 kDa |
AA Sequence : | MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FGF19 fibroblast growth factor 19 [ Homo sapiens (human) ] |
Official Symbol | FGF19 |
Synonyms | FGF19; fibroblast growth factor 19; FGF-19; |
Gene ID | 9965 |
mRNA Refseq | NM_005117 |
Protein Refseq | NP_005108 |
MIM | 603891 |
UniProt ID | O95750 |
◆ Recombinant Proteins | ||
FGF19-1485H | Recombinant Human FGF19 Protein, His-tagged | +Inquiry |
FGF19-238H | Recombinant Human FGF19 protein | +Inquiry |
FGF19-032H | Recombinant Human FGF19 Protein | +Inquiry |
FGF19-906H | Recombinant Human FGF19 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGF19-121F | Active Recombinant Human FGF19 Protein (195 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF19-6244HCL | Recombinant Human FGF19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF19 Products
Required fields are marked with *
My Review for All FGF19 Products
Required fields are marked with *
0
Inquiry Basket