Recombinant Human FGF21 protein, GST-tagged
| Cat.No. : | FGF21-301123H |
| Product Overview : | Recombinant Human FGF21 (60-209 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | His60-Ser209 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | HLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | FGF21 fibroblast growth factor 21 [ Homo sapiens ] |
| Official Symbol | FGF21 |
| Synonyms | FGF21; fibroblast growth factor 21; FGF-21; |
| Gene ID | 26291 |
| mRNA Refseq | NM_019113 |
| Protein Refseq | NP_061986 |
| MIM | 609436 |
| UniProt ID | Q9NSA1 |
| ◆ Recombinant Proteins | ||
| Fgf21-109M | Recombinant Mouse Fibroblast Growth Factor 21 | +Inquiry |
| FGF21-120F | Active Recombinant Human FGF21 Protein (182 aa) | +Inquiry |
| FGF21-415F | Active Recombinant Human FGF21 Protein (182 aa) | +Inquiry |
| Fgf21-5453M | Recombinant Mouse Fgf21 Protein (Ala29-Ser210), N-His tagged | +Inquiry |
| FGF21-932P | Recombinant Pig FGF21 Protein, His&GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGF21-1890MCL | Recombinant Mouse FGF21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF21 Products
Required fields are marked with *
My Review for All FGF21 Products
Required fields are marked with *
