Recombinant Human FGF23 Full Length Protein, His tagged

• Cat.No.: FGF23-3586H
• Product Overview: Recombinant Human FGF23 protein(Tyr25-Ile251), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: Tyr25-Ile251
• Tag: C-His
• Form: Liquid in sterile PBS, pH7.4.
• Molecular Mass: The protein has a calculated MW of 28 kDa.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.0 mg/ml.
• Reconstitution: Centrifuge the vial at 4°C before opening to recover the entire contents.
• UniProt ID-Weblink: http://www.uniprot.org/uniprot/
• AA Sequence: YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIGGGSGGGSHHHHHHHHHH

Gene Information

• Gene Name: FGF23 fibroblast growth factor 23 [ Homo sapiens ]
• Official Symbol: FGF23
• Synonyms: FGF23; fibroblast growth factor 23
• Gene ID: 53406