Recombinant Human FGF23 Full Length Protein, His tagged

Cat.No. : FGF23-3586H
Product Overview : Recombinant Human FGF23 protein(Tyr25-Ile251), fused with C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : Tyr25-Ile251
Tag : C-His
Form : Liquid in sterile PBS, pH7.4.
Molecular Mass : The protein has a calculated MW of 28 kDa.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.0 mg/ml.
Reconstitution : Centrifuge the vial at 4°C before opening to recover the entire contents.
UniProt ID-Weblink : http://www.uniprot.org/uniprot/
AA Sequence : YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIGGGSGGGSHHHHHHHHHH
Gene Name FGF23 fibroblast growth factor 23 [ Homo sapiens ]
Official Symbol FGF23
Synonyms FGF23; fibroblast growth factor 23;
Gene ID 53406

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF23 Products

Required fields are marked with *

My Review for All FGF23 Products

Required fields are marked with *

0
cart-icon
0
compare icon