Recombinant Human FGF23 Full Length Protein, His tagged
| Cat.No. : | FGF23-3586H |
| Product Overview : | Recombinant Human FGF23 protein(Tyr25-Ile251), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | Tyr25-Ile251 |
| Tag : | C-His |
| Form : | Liquid in sterile PBS, pH7.4. |
| Molecular Mass : | The protein has a calculated MW of 28 kDa. |
| Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
| Purity : | > 90 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1.0 mg/ml. |
| Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
| UniProt ID-Weblink : | http://www.uniprot.org/uniprot/ |
| AA Sequence : | YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIGGGSGGGSHHHHHHHHHH |
| Gene Name | FGF23 fibroblast growth factor 23 [ Homo sapiens ] |
| Official Symbol | FGF23 |
| Synonyms | FGF23; fibroblast growth factor 23; |
| Gene ID | 53406 |
| ◆ Recombinant Proteins | ||
| FGF23-299H | Recombinant Full Length Human FGF23 Protein, C-His-tagged | +Inquiry |
| FGF23-1699R | Recombinant Rhesus monkey FGF23 Protein, His-tagged | +Inquiry |
| FGF23-2333R | Recombinant Rat FGF23 Protein | +Inquiry |
| FGF23-684H | Recombinant Human FGF23 Protein, His-tagged | +Inquiry |
| Fgf23-903R | Recombinant Rat Fgf23 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGF23-6241HCL | Recombinant Human FGF23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF23 Products
Required fields are marked with *
My Review for All FGF23 Products
Required fields are marked with *



