Recombinant Human GDF9 protein, GST-tagged
Cat.No. : | GDF9-2953H |
Product Overview : | Recombinant Human GDF9 protein(O60383)(320-454aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 320-454aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.5 kDa |
AA Sequence : | GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GDF9 growth differentiation factor 9 [ Homo sapiens ] |
Official Symbol | GDF9 |
Synonyms | GDF9; growth differentiation factor 9; growth/differentiation factor 9; GDF-9; |
Gene ID | 2661 |
mRNA Refseq | NM_005260 |
Protein Refseq | NP_005251 |
MIM | 601918 |
UniProt ID | O60383 |
◆ Recombinant Proteins | ||
GDF9-6290M | Recombinant Mouse GDF9 Protein | +Inquiry |
GDF-9-4633C | Recombinant Chicken GDF-9 protein, His&Myc-tagged | +Inquiry |
GDF9-453S | Recombinant Sheep GDF9 protein, His&Myc-tagged | +Inquiry |
GDF9-223H | Recombinant Human Growth Differentiation Factor 9, His-tagged | +Inquiry |
Gdf9-180M | Active Recombinant Mouse Gdf9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDF9-5966HCL | Recombinant Human GDF9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDF9 Products
Required fields are marked with *
My Review for All GDF9 Products
Required fields are marked with *