Recombinant Human GDF9 protein, GST-tagged
| Cat.No. : | GDF9-2953H |
| Product Overview : | Recombinant Human GDF9 protein(O60383)(320-454aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 320-454aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42.5 kDa |
| AA Sequence : | GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | GDF9 growth differentiation factor 9 [ Homo sapiens ] |
| Official Symbol | GDF9 |
| Synonyms | GDF9; growth differentiation factor 9; growth/differentiation factor 9; GDF-9; |
| Gene ID | 2661 |
| mRNA Refseq | NM_005260 |
| Protein Refseq | NP_005251 |
| MIM | 601918 |
| UniProt ID | O60383 |
| ◆ Recombinant Proteins | ||
| GDF9-5241HF | Recombinant Full Length Human GDF9 Protein, GST-tagged | +Inquiry |
| Gdf9-726M | Active Recombinant Mouse Growth Differentiation Factor 9 | +Inquiry |
| GDF9-053H | Active Recombinant Human GDF9 Protein | +Inquiry |
| GDF9-223H | Recombinant Human Growth Differentiation Factor 9, His-tagged | +Inquiry |
| GDF9-245H | Recombinant Human Growth Differentiation Factor 9 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GDF9-5966HCL | Recombinant Human GDF9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDF9 Products
Required fields are marked with *
My Review for All GDF9 Products
Required fields are marked with *



