Recombinant Human GFRAL protein, His-tagged
Cat.No. : | GFRAL-3065H |
Product Overview : | Recombinant Human GFRAL protein(94-338 aa), fused to His tag, was expressed in E. coli. |
Availability | September 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 94-338 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GFRAL GDNF family receptor alpha like [ Homo sapiens ] |
Official Symbol | GFRAL |
Synonyms | GFRAL; GDNF family receptor alpha like; C6orf144, chromosome 6 open reading frame 144; GDNF family receptor alpha-like; bA360D14.1; GRAL; UNQ9356; IVFI9356; C6orf144; |
Gene ID | 389400 |
mRNA Refseq | NM_207410 |
Protein Refseq | NP_997293 |
UniProt ID | Q6UXV0 |
◆ Recombinant Proteins | ||
GFRAL-103H | Recombinant Human GFRAL Protein, Ser19-Glu351, C-His-Avi tagged, Biotinylated | +Inquiry |
GFRAL-4633C | Recombinant Cynomolgus GFRAL protein, His-Avi-tagged | +Inquiry |
Gfral-060M | Recombinant Mouse Gfral protein, His-Avi-tagged | +Inquiry |
Gfral-264M | Recombinant Mouse Gfral Protein, Gln20-Glu350, N-His-Avi tagged, Biotinylated | +Inquiry |
GFRAL-1929H | Recombinant Human GFRAL Protein (19-351 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFRAL Products
Required fields are marked with *
My Review for All GFRAL Products
Required fields are marked with *