Recombinant Human GSK3B protein, His-tagged
Cat.No. : | GSK3B-2997H |
Product Overview : | Recombinant Human GSK3B protein(P49841)(1-420aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-420aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 50.7 kDa |
AA Sequence : | MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GSK3B glycogen synthase kinase 3 beta [ Homo sapiens ] |
Official Symbol | GSK3B |
Synonyms | GSK3B; glycogen synthase kinase 3 beta; glycogen synthase kinase-3 beta; GSK-3 beta; GSK3beta isoform; serine/threonine-protein kinase GSK3B; |
Gene ID | 2932 |
mRNA Refseq | NM_001146156 |
Protein Refseq | NP_001139628 |
MIM | 605004 |
UniProt ID | P49841 |
◆ Recombinant Proteins | ||
GSK3B-3329HF | Recombinant Full Length Human GSK3B Protein, GST-tagged | +Inquiry |
Gsk3b-3318M | Recombinant Mouse Gsk3b Protein, Myc/DDK-tagged | +Inquiry |
GSK3B-2997H | Recombinant Human GSK3B protein, His-tagged | +Inquiry |
GSK3B-1540H | Recombinant Human GSK3 beta, Unactive, GST-tagged | +Inquiry |
Gsk3b-2521M | Active Recombinant Mouse Gsk3b protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSK3B-717HCL | Recombinant Human GSK3B cell lysate | +Inquiry |
GSK3B-534MCL | Recombinant Mouse GSK3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GSK3B Products
Required fields are marked with *
My Review for All GSK3B Products
Required fields are marked with *
0
Inquiry Basket