Recombinant Human GSK3B protein, His-tagged
| Cat.No. : | GSK3B-2997H |
| Product Overview : | Recombinant Human GSK3B protein(P49841)(1-420aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-420aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 50.7 kDa |
| AA Sequence : | MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | GSK3B glycogen synthase kinase 3 beta [ Homo sapiens ] |
| Official Symbol | GSK3B |
| Synonyms | GSK3B; glycogen synthase kinase 3 beta; glycogen synthase kinase-3 beta; GSK-3 beta; GSK3beta isoform; serine/threonine-protein kinase GSK3B; |
| Gene ID | 2932 |
| mRNA Refseq | NM_001146156 |
| Protein Refseq | NP_001139628 |
| MIM | 605004 |
| UniProt ID | P49841 |
| ◆ Recombinant Proteins | ||
| GSK3B-616H | Active Recombinant Human GSK3B protein, His-tagged | +Inquiry |
| GSK3B-406H | Recombinant Human glycogen synthase kinase 3 beta, His-tagged | +Inquiry |
| GSK3B-1027H | Recombinant Human GSK3B Protein, His (Fc)-Avi-tagged | +Inquiry |
| GSK3B-3329HF | Recombinant Full Length Human GSK3B Protein, GST-tagged | +Inquiry |
| GSK3B-4399H | Recombinant Human GSK3B Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSK3B-534MCL | Recombinant Mouse GSK3B cell lysate | +Inquiry |
| GSK3B-717HCL | Recombinant Human GSK3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSK3B Products
Required fields are marked with *
My Review for All GSK3B Products
Required fields are marked with *
