Recombinant Human IL-13 protein, His-tagged
Cat.No. : | IL-13-3015H |
Product Overview : | Recombinant Human IL-13 protein(25-146 aa), fused to His tag, was expressed in E. coli. |
Availability | July 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-146 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
◆ Recombinant Proteins | ||
IL13-1985P | Recombinant Pig IL13 protein | +Inquiry |
IL13-120H | Recombinant Human IL13 Protein, His-tagged | +Inquiry |
IL13-3170C | Recombinant Cat IL13 protein(34-144aa), His-tagged | +Inquiry |
IL13-3589H | Recombinant Human IL13 protein, His-tagged | +Inquiry |
IL13-1002H | Recombinant Human IL13 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-001HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL13 Products
Required fields are marked with *
My Review for All IL13 Products
Required fields are marked with *