Recombinant Human IL17D protein, His-tagged
Cat.No. : | IL17D-3185H |
Product Overview : | Recombinant Human IL17D protein(1-202 aa), fused to His tag, was expressed in E. coli. |
Availability | August 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-202 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | IL17D interleukin 17D [ Homo sapiens ] |
Official Symbol | IL17D |
Synonyms | IL17D; interleukin 17D; interleukin-17D; FLJ30846; IL 17D; IL 22; IL 27; IL27; interleukin 27; interleukin-27; IL-22; IL-27; IL-17D; |
Gene ID | 53342 |
mRNA Refseq | NM_138284 |
Protein Refseq | NP_612141 |
MIM | 607587 |
UniProt ID | Q8TAD2 |
◆ Recombinant Proteins | ||
IL17D-2924Z | Recombinant Zebrafish IL17D | +Inquiry |
Il17d-1664M | Recombinant Mouse Il17d Protein, His-tagged | +Inquiry |
IL17D-3659H | Recombinant Human IL17D Protein (Ala18-Pro202), N-His tagged | +Inquiry |
Il17d-01M | Active Recombinant Mouse Il17d Protein, His-Tagged | +Inquiry |
IL17D-3185H | Recombinant Human IL17D protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17D-852HCL | Recombinant Human IL17D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17D Products
Required fields are marked with *
My Review for All IL17D Products
Required fields are marked with *