Recombinant Human IL27RA Protein, GST-tagged
| Cat.No. : | IL27RA-5203H |
| Product Overview : | Human IL27RA partial ORF ( NP_004834, 33 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | In mice, CD4+ helper T-cells differentiate into type 1 (Th1) cells, which are critical for cell-mediated immunity, predominantly under the influence of IL12. Also, IL4 influences their differentiation into type 2 (Th2) cells, which are critical for most antibody responses. Mice deficient in these cytokines, their receptors, or associated transcription factors have impaired, but are not absent of, Th1 or Th2 immune responses. This gene encodes a protein which is similar to the mouse T-cell cytokine receptor Tccr at the amino acid level, and is predicted to be a glycosylated transmembrane protein. [provided by RefSeq |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | QGSAGPLQCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNLETQMKPNAPR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | IL27RA interleukin 27 receptor, alpha [ Homo sapiens ] |
| Official Symbol | IL27RA |
| Synonyms | IL27RA; interleukin 27 receptor, alpha; interleukin-27 receptor subunit alpha; CRL1; IL 27R; T cell cytokine receptor type 1; TCCR; WSX 1; WSX1; zcytor1; IL-27RA; IL-27R-alpha; IL-27R subunit alpha; cytokine receptor-like 1; class I cytokine receptor; IL-27 receptor subunit alpha; T-cell cytokine receptor type 1; type I T-cell cytokine receptor; IL27R; |
| Gene ID | 9466 |
| mRNA Refseq | NM_004843 |
| Protein Refseq | NP_004834 |
| MIM | 605350 |
| UniProt ID | Q6UWB1 |
| ◆ Recombinant Proteins | ||
| IL27RA-2622H | Recombinant Human IL27RA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| IL27RA-328H | Recombinant Human IL27RA Protein, Fc-tagged | +Inquiry |
| IL27RA-018H | Recombinant Human IL27RA protein, Fc-tagged | +Inquiry |
| IL27RA-6756H | Recombinant Human IL27RA protein, hFc-tagged | +Inquiry |
| IL27RA-1605H | Recombinant Human IL27RA protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL27RA-2909HCL | Recombinant Human IL27RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL27RA Products
Required fields are marked with *
My Review for All IL27RA Products
Required fields are marked with *
