Recombinant Human IL27RA Protein, GST-tagged

Cat.No. : IL27RA-5203H
Product Overview : Human IL27RA partial ORF ( NP_004834, 33 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : In mice, CD4+ helper T-cells differentiate into type 1 (Th1) cells, which are critical for cell-mediated immunity, predominantly under the influence of IL12. Also, IL4 influences their differentiation into type 2 (Th2) cells, which are critical for most antibody responses. Mice deficient in these cytokines, their receptors, or associated transcription factors have impaired, but are not absent of, Th1 or Th2 immune responses. This gene encodes a protein which is similar to the mouse T-cell cytokine receptor Tccr at the amino acid level, and is predicted to be a glycosylated transmembrane protein. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : QGSAGPLQCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNLETQMKPNAPR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IL27RA interleukin 27 receptor, alpha [ Homo sapiens ]
Official Symbol IL27RA
Synonyms IL27RA; interleukin 27 receptor, alpha; interleukin-27 receptor subunit alpha; CRL1; IL 27R; T cell cytokine receptor type 1; TCCR; WSX 1; WSX1; zcytor1; IL-27RA; IL-27R-alpha; IL-27R subunit alpha; cytokine receptor-like 1; class I cytokine receptor; IL-27 receptor subunit alpha; T-cell cytokine receptor type 1; type I T-cell cytokine receptor; IL27R;
Gene ID 9466
mRNA Refseq NM_004843
Protein Refseq NP_004834
MIM 605350
UniProt ID Q6UWB1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL27RA Products

Required fields are marked with *

My Review for All IL27RA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon