Recombinant Human IL4R Protein, C-His-tagged
Cat.No. : | IL4R-068H |
Product Overview : | Recombinant Human IL4R Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The IL-2 receptor is a multicomponent complex consisting of three subunits, α, β and γ, each of which is required for high affinity binding of IL-2. The α chain functions primarily in binding IL-2, whereas the β and γ chains contribute to IL-2 binding and are essential to IL-2-induced activation of signaling pathways leading to T cell growth. Both IL-4R and IL-7R were initially described as single chain, high-affinity ligand-binding cytokine receptors. However, it is now well established that the IL-2Rγ chain functions as a second subunit of the high affinity IL-4R and IL-7R receptors. Consequently, the originally described subunits of these latter receptors are now referred to as IL-4Rα and IL-7Rα, respectively, while the common subunit is referred to as γc. Although the common γ chain enhances ligand binding in these three cytokine receptors, it has no capacity to bind these ligands on its own. There is evidence that the γc chain is also a subunit of IL-13R. |
Molecular Mass : | ~23 kDa |
AA Sequence : | KVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | IL4R interleukin 4 receptor [ Homo sapiens (human) ] |
Official Symbol | IL4R |
Synonyms | IL4R; interleukin 4 receptor; interleukin-4 receptor subunit alpha; CD124; IL-4 receptor subunit alpha; interleukin-4 receptor alpha chain; IL4RA; IL-4RA; |
Gene ID | 3566 |
mRNA Refseq | NM_000418 |
Protein Refseq | NP_000409 |
MIM | 147781 |
UniProt ID | P24394 |
◆ Native Proteins | ||
IL4R-44H | Active Recombinant Human IL4R Homodimer Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4R-2719HCL | Recombinant Human IL4R cell lysate | +Inquiry |
IL4R-1051RCL | Recombinant Rat IL4R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL4R Products
Required fields are marked with *
My Review for All IL4R Products
Required fields are marked with *