Recombinant Human IL4R Protein, C-His-tagged
| Cat.No. : | IL4R-068H |
| Product Overview : | Recombinant Human IL4R Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | The IL-2 receptor is a multicomponent complex consisting of three subunits, α, β and γ, each of which is required for high affinity binding of IL-2. The α chain functions primarily in binding IL-2, whereas the β and γ chains contribute to IL-2 binding and are essential to IL-2-induced activation of signaling pathways leading to T cell growth. Both IL-4R and IL-7R were initially described as single chain, high-affinity ligand-binding cytokine receptors. However, it is now well established that the IL-2Rγ chain functions as a second subunit of the high affinity IL-4R and IL-7R receptors. Consequently, the originally described subunits of these latter receptors are now referred to as IL-4Rα and IL-7Rα, respectively, while the common subunit is referred to as γc. Although the common γ chain enhances ligand binding in these three cytokine receptors, it has no capacity to bind these ligands on its own. There is evidence that the γc chain is also a subunit of IL-13R. |
| Molecular Mass : | ~23 kDa |
| AA Sequence : | KVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH |
| Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : | For research use only, not for use in diagnostic procedure. |
| Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Concentration : | ≥0.5 mg/mL |
| Storage Buffer : | PBS, 4M Urea, pH7.4 |
| Gene Name | IL4R interleukin 4 receptor [ Homo sapiens (human) ] |
| Official Symbol | IL4R |
| Synonyms | IL4R; interleukin 4 receptor; interleukin-4 receptor subunit alpha; CD124; IL-4 receptor subunit alpha; interleukin-4 receptor alpha chain; IL4RA; IL-4RA; |
| Gene ID | 3566 |
| mRNA Refseq | NM_000418 |
| Protein Refseq | NP_000409 |
| MIM | 147781 |
| UniProt ID | P24394 |
| ◆ Recombinant Proteins | ||
| IL4R-5796P | Recombinant Pig IL4R protein, His-tagged | +Inquiry |
| IL4R-3234H | Recombinant Human IL4R protein, His-tagged | +Inquiry |
| IL4R-588H | Active Recombinant Human IL4R Protein, His & Avi-tagged, Biotinylated | +Inquiry |
| IL4R-2321H | Recombinant Human IL4R Protein, His-tagged | +Inquiry |
| IL4R-2408H | Recombinant Human IL4R protein(Met1-His232), hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL4R-1051RCL | Recombinant Rat IL4R cell lysate | +Inquiry |
| IL4R-2719HCL | Recombinant Human IL4R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL4R Products
Required fields are marked with *
My Review for All IL4R Products
Required fields are marked with *
