Recombinant Human ITGA2B protein(751-820 aa), C-His-tagged
| Cat.No. : | ITGA2B-2597H |
| Product Overview : | Recombinant Human ITGA2B protein(P08514)(751-820 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 751-820 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 10.5 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | QLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNN |
| Gene Name | ITGA2B integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41) [ Homo sapiens ] |
| Official Symbol | ITGA2B |
| Synonyms | ITGA2B; integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); GP2B, integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41B); integrin alpha-IIb; CD41; CD41B; GPalpha IIb; platelet-specific antigen BAK; platelet membrane glycoprotein IIb; platelet fibrinogen receptor, alpha subunit; GT; GTA; GP2B; HPA3; GPIIb; BDPLT2; |
| Gene ID | 3674 |
| mRNA Refseq | NM_000419 |
| Protein Refseq | NP_000410 |
| MIM | 607759 |
| UniProt ID | P08514 |
| ◆ Recombinant Proteins | ||
| ITGA2B-4999H | Recombinant Human ITGA2B Protein, GST-tagged | +Inquiry |
| ITGA2B-174H | Recombinant Human ITGA2B, GST-tagged | +Inquiry |
| ITGA2B-2598H | Recombinant Human ITGA2B protein(751-820 aa), C-hFc & C-His-tagged | +Inquiry |
| ITGA2B-2615H | Recombinant Human ITGA2B Protein, MYC/DDK-tagged | +Inquiry |
| ITGA2B-5758H | Recombinant Human ITGA2B protein, His & T7-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ITGA2B-10H | Native Human GPIIbIIIa | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGA2B Products
Required fields are marked with *
My Review for All ITGA2B Products
Required fields are marked with *
