Recombinant Human NKIRAS1 Protein, GST-tagged
Cat.No. : | NKIRAS1-5890H |
Product Overview : | Human NKIRAS1 partial ORF ( AAH12145, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | NKIRAS1 (NFKB Inhibitor Interacting Ras Like 1) is a Protein Coding gene. Among its related pathways are NF-KappaB Family Pathway. GO annotations related to this gene include GTP binding and GTPase activity. An important paralog of this gene is NKIRAS2. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLVYSVNNLESFQRVELL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NKIRAS1 NFKB inhibitor interacting Ras-like 1 [ Homo sapiens ] |
Official Symbol | NKIRAS1 |
Synonyms | NKIRAS1; NFKB inhibitor interacting Ras-like 1; NFKB inhibitor interacting Ras like protein 1; NF-kappa-B inhibitor-interacting Ras-like protein 1; kappaB Ras1; KBRAS1; kappa B-ras 1; kappa B-Ras protein 1; I-kappa-B-interacting Ras-like protein 1; NFKB inhibitor interacting Ras-like protein 1; kappaB-Ras1; |
Gene ID | 28512 |
mRNA Refseq | NM_020345 |
Protein Refseq | NP_065078 |
MIM | 604496 |
UniProt ID | Q9NYS0 |
◆ Recombinant Proteins | ||
NKIRAS1-5890H | Recombinant Human NKIRAS1 Protein, GST-tagged | +Inquiry |
NKIRAS1-5859Z | Recombinant Zebrafish NKIRAS1 | +Inquiry |
NKIRAS1-748C | Recombinant Cynomolgus NKIRAS1 Protein, His-tagged | +Inquiry |
Nkiras1-4421M | Recombinant Mouse Nkiras1 Protein, Myc/DDK-tagged | +Inquiry |
NKIRAS1-492C | Recombinant Cynomolgus Monkey NKIRAS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NKIRAS1-3818HCL | Recombinant Human NKIRAS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NKIRAS1 Products
Required fields are marked with *
My Review for All NKIRAS1 Products
Required fields are marked with *