Recombinant Human NKIRAS1 Protein, GST-tagged

Cat.No. : NKIRAS1-5890H
Product Overview : Human NKIRAS1 partial ORF ( AAH12145, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : NKIRAS1 (NFKB Inhibitor Interacting Ras Like 1) is a Protein Coding gene. Among its related pathways are NF-KappaB Family Pathway. GO annotations related to this gene include GTP binding and GTPase activity. An important paralog of this gene is NKIRAS2.
Molecular Mass : 36.74 kDa
AA Sequence : MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLVYSVNNLESFQRVELL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NKIRAS1 NFKB inhibitor interacting Ras-like 1 [ Homo sapiens ]
Official Symbol NKIRAS1
Synonyms NKIRAS1; NFKB inhibitor interacting Ras-like 1; NFKB inhibitor interacting Ras like protein 1; NF-kappa-B inhibitor-interacting Ras-like protein 1; kappaB Ras1; KBRAS1; kappa B-ras 1; kappa B-Ras protein 1; I-kappa-B-interacting Ras-like protein 1; NFKB inhibitor interacting Ras-like protein 1; kappaB-Ras1;
Gene ID 28512
mRNA Refseq NM_020345
Protein Refseq NP_065078
MIM 604496
UniProt ID Q9NYS0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NKIRAS1 Products

Required fields are marked with *

My Review for All NKIRAS1 Products

Required fields are marked with *

0
cart-icon