Recombinant Human PLAU therapeutic protein(Urokinase)
Cat.No. : | PLAU-P009H |
Product Overview : | Low molecular weight form of human urokinase, that consists of an A chain of 2,000 daltons linked by a sulfhydryl bond to a B chain of 30,400 daltons. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 276 Aa |
Description : | This gene encodes a serine protease involved in degradation of the extracellular matrix and possibly tumor cell migration and proliferation. A specific polymorphism in this gene may be associated with late-onset Alzheimer's disease and also with decreased affinity for fibrin-binding. This protein converts plasminogen to plasmin by specific cleavage of an Arg-Val bond in plasminogen. Plasmin in turn cleaves this protein at a Lys-Ile bond to form a two-chain derivative in which a single disulfide bond connects the amino-terminal A-chain to the catalytically active, carboxy-terminal B-chain. This two-chain derivative is also called HMW-uPA (high molecular weight uPA). HMW-uPA can be further processed into LMW-uPA (low molecular weight uPA) by cleavage of chain A into a short chain A (A1) and an amino-terminal fragment. LMW-uPA is proteolytically active but does not bind to the uPA receptor. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. The expression product is the active ingredient of Abbokinase and Kinlytic. |
Molecular Mass : | 31.1KDa |
AA Sequence : | KPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCF IDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQT ICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWK TDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Alias : | PLAU; ATF; QPD; u-PA; BDPLT5; Kinase (enzyme-activating), uro-urokinase; TCUK; Tissue culture urokinase; Two-chain urokinase; Urochinasi; Urokinase; Urokinasum; Uroquinasa |
Gene Name | PLAU plasminogen activator, urokinase [ Homo sapiens ] |
Official Symbol | PLAU |
Synonyms | PLAU; plasminogen activator, urokinase; urokinase-type plasminogen activator; UPA; URK; U-plasminogen activator; plasminogen activator, urinary; ATF; QPD; u-PA; BDPLT5; |
Gene ID | 5328 |
mRNA Refseq | NM_001145031 |
Protein Refseq | NP_001138503 |
MIM | 191840 |
UniProt ID | P00749 |
Chromosome Location | 10q24 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Blood Clotting Cascade, organism-specific biosystem; Complement and Coagulation Cascades, organism-specific biosystem; Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; Dissolution of Fibrin Clot, organism-specific biosystem; |
Function | peptidase activity; protein binding; serine-type endopeptidase activity; |
◆ Recombinant Proteins | ||
Plau-580M | Recombinant Mouse Plau protein, His & T7-tagged | +Inquiry |
Plau-1298M | Recombinant Mouse Plau Protein | +Inquiry |
PLAU-12913M | Recombinant Mouse PLAU Protein | +Inquiry |
PLAU-1697H | Recombinant Human PLAU Protein, His (Fc)-Avi-tagged | +Inquiry |
PLAU-2467H | Recombinant Human Plasminogen Activator, Urokinase | +Inquiry |
◆ Native Proteins | ||
PLAU -14H | Native Human HMW urokinase, fluorescein labeled | +Inquiry |
PLAU-22H | Native Human PLAU protein | +Inquiry |
PLAU-31689TH | Active Native Human Urokinase protein | +Inquiry |
PLAU-31687TH | Native Human PLAU | +Inquiry |
PLAU -15H | Native Human HMW urokinase, HRP conjugate | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLAU-1734HCL | Recombinant Human PLAU cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLAU Products
Required fields are marked with *
My Review for All PLAU Products
Required fields are marked with *
0
Inquiry Basket