Recombinant Human PRKDC

• Cat.No.: PRKDC-28357TH
• Product Overview: Recombinant fragment corresponding to amino acids 4019-4128 of Human DNA PKcs with a N terminal proprietary tag; Predicted MWt 37.73 kDa including tag

Specification

• Description: This gene encodes the catalytic subunit of the DNA-dependent protein kinase (DNA-PK). It functions with the Ku70/Ku80 heterodimer protein in DNA double strand break repair and recombination. The protein encoded is a member of the PI3/PI4-kinase family.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAV ITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGL SEETQVKCLMDQATDPNILGRTWEGWEPWM
• Sequence Similarities: Belongs to the PI3/PI4-kinase family.Contains 1 FAT domain.Contains 1 FATC domain.Contains 2 HEAT repeats.Contains 1 PI3K/PI4K domain.Contains 3 TPR repeats.

Gene Information

• Gene Name: PRKDC protein kinase, DNA-activated, catalytic polypeptide [ Homo sapiens ]
• Official Symbol: PRKDC
• Synonyms: PRKDC; protein kinase, DNA-activated, catalytic polypeptide; HYRC, HYRC1; DNA-dependent protein kinase catalytic subunit; DNA PKcs; DNAPK; DNPK1; p350; XRCC7
• Gene ID: 5591
• mRNA Refseq: NM_001081640
• Protein Refseq: NP_001075109
• MIM: 600899
• Uniprot ID: P78527
• Chromosome Location: 8q11
• Pathway: BARD1 signaling events, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Class I PI3K signaling events mediated by Akt, organism-specific biosystem
• Function: ATP binding; DNA binding; DNA-dependent protein kinase activity; enzyme binding; nucleotide binding