Recombinant Human PRKDC
Cat.No. : | PRKDC-28357TH |
Product Overview : | Recombinant fragment corresponding to amino acids 4019-4128 of Human DNA PKcs with a N terminal proprietary tag; Predicted MWt 37.73 kDa including tag |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | This gene encodes the catalytic subunit of the DNA-dependent protein kinase (DNA-PK). It functions with the Ku70/Ku80 heterodimer protein in DNA double strand break repair and recombination. The protein encoded is a member of the PI3/PI4-kinase family. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAV ITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGL SEETQVKCLMDQATDPNILGRTWEGWEPWM |
Sequence Similarities : | Belongs to the PI3/PI4-kinase family.Contains 1 FAT domain.Contains 1 FATC domain.Contains 2 HEAT repeats.Contains 1 PI3K/PI4K domain.Contains 3 TPR repeats. |
Gene Name | PRKDC protein kinase, DNA-activated, catalytic polypeptide [ Homo sapiens ] |
Official Symbol | PRKDC |
Synonyms | PRKDC; protein kinase, DNA-activated, catalytic polypeptide; HYRC, HYRC1; DNA-dependent protein kinase catalytic subunit; DNA PKcs; DNAPK; DNPK1; p350; XRCC7; |
Gene ID | 5591 |
mRNA Refseq | NM_001081640 |
Protein Refseq | NP_001075109 |
MIM | 600899 |
Uniprot ID | P78527 |
Chromosome Location | 8q11 |
Pathway | BARD1 signaling events, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Class I PI3K signaling events mediated by Akt, organism-specific biosystem; |
Function | ATP binding; DNA binding; DNA-dependent protein kinase activity; enzyme binding; nucleotide binding; |
◆ Recombinant Proteins | ||
PRKDC-859H | Recombinant Human PRKDC Protein | +Inquiry |
Prkdc-1774M | Recombinant Mouse Prkdc protein, His & T7-tagged | +Inquiry |
PRKDC-28357TH | Recombinant Human PRKDC | +Inquiry |
PRKDC-64HFL | Active Recombinant Full Length Human PRKDC Protein, Flag-tagged | +Inquiry |
PRKDC-6226C | Recombinant Chicken PRKDC | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKDC Products
Required fields are marked with *
My Review for All PRKDC Products
Required fields are marked with *