Recombinant Human PRKDC

Cat.No. : PRKDC-28357TH
Product Overview : Recombinant fragment corresponding to amino acids 4019-4128 of Human DNA PKcs with a N terminal proprietary tag; Predicted MWt 37.73 kDa including tag
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : This gene encodes the catalytic subunit of the DNA-dependent protein kinase (DNA-PK). It functions with the Ku70/Ku80 heterodimer protein in DNA double strand break repair and recombination. The protein encoded is a member of the PI3/PI4-kinase family.
Molecular Weight : 37.730kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAV ITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGL SEETQVKCLMDQATDPNILGRTWEGWEPWM
Sequence Similarities : Belongs to the PI3/PI4-kinase family.Contains 1 FAT domain.Contains 1 FATC domain.Contains 2 HEAT repeats.Contains 1 PI3K/PI4K domain.Contains 3 TPR repeats.
Gene Name PRKDC protein kinase, DNA-activated, catalytic polypeptide [ Homo sapiens ]
Official Symbol PRKDC
Synonyms PRKDC; protein kinase, DNA-activated, catalytic polypeptide; HYRC, HYRC1; DNA-dependent protein kinase catalytic subunit; DNA PKcs; DNAPK; DNPK1; p350; XRCC7;
Gene ID 5591
mRNA Refseq NM_001081640
Protein Refseq NP_001075109
MIM 600899
Uniprot ID P78527
Chromosome Location 8q11
Pathway BARD1 signaling events, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, organism-specific biosystem; Cell cycle, conserved biosystem; Class I PI3K signaling events mediated by Akt, organism-specific biosystem;
Function ATP binding; DNA binding; DNA-dependent protein kinase activity; enzyme binding; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRKDC Products

Required fields are marked with *

My Review for All PRKDC Products

Required fields are marked with *

0
cart-icon