Recombinant Human PRKDC protein, His-tagged
| Cat.No. : | PRKDC-3252H |
| Product Overview : | Recombinant Human PRKDC protein(3979-4128 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 3979-4128 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LMYSIMVHALRAFRSDPGLLTNTMDVFVKEPSFDWKNFEQKMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGWEPWM |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PRKDC protein kinase, DNA-activated, catalytic polypeptide [ Homo sapiens ] |
| Official Symbol | PRKDC |
| Synonyms | PRKDC; protein kinase, DNA-activated, catalytic polypeptide; HYRC, HYRC1; DNA-dependent protein kinase catalytic subunit; DNA PKcs; DNAPK; DNPK1; p350; XRCC7; p460; DNA-PK catalytic subunit; hyper-radiosensitivity of murine scid mutation, complementing 1; HYRC; HYRC1; DNA-PKcs; |
| Gene ID | 5591 |
| mRNA Refseq | NM_001081640 |
| Protein Refseq | NP_001075109 |
| MIM | 600899 |
| UniProt ID | P78527 |
| ◆ Recombinant Proteins | ||
| PRKDC-7100M | Recombinant Mouse PRKDC Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRKDC-859H | Recombinant Human PRKDC Protein | +Inquiry |
| Prkdc-3370M | Recombinant Mouse Prkdc protein, His-tagged | +Inquiry |
| PRKDC-860H | Recombinant Human PRKDC Protein | +Inquiry |
| PRKDC-3252H | Recombinant Human PRKDC protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRKDC-280HKCL | Human PRKDC Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKDC Products
Required fields are marked with *
My Review for All PRKDC Products
Required fields are marked with *
