Recombinant Human PRKDC protein, His-tagged
Cat.No. : | PRKDC-3252H |
Product Overview : | Recombinant Human PRKDC protein(3979-4128 aa), fused to His tag, was expressed in E. coli. |
Availability | September 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 3979-4128 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LMYSIMVHALRAFRSDPGLLTNTMDVFVKEPSFDWKNFEQKMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGWEPWM |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PRKDC protein kinase, DNA-activated, catalytic polypeptide [ Homo sapiens ] |
Official Symbol | PRKDC |
Synonyms | PRKDC; protein kinase, DNA-activated, catalytic polypeptide; HYRC, HYRC1; DNA-dependent protein kinase catalytic subunit; DNA PKcs; DNAPK; DNPK1; p350; XRCC7; p460; DNA-PK catalytic subunit; hyper-radiosensitivity of murine scid mutation, complementing 1; HYRC; HYRC1; DNA-PKcs; |
Gene ID | 5591 |
mRNA Refseq | NM_001081640 |
Protein Refseq | NP_001075109 |
MIM | 600899 |
UniProt ID | P78527 |
◆ Recombinant Proteins | ||
PRKDC-64HFL | Active Recombinant Full Length Human PRKDC Protein, Flag-tagged | +Inquiry |
PRKDC-860H | Recombinant Human PRKDC Protein | +Inquiry |
Prkdc-1774M | Recombinant Mouse Prkdc protein, His & T7-tagged | +Inquiry |
PRKDC-7100M | Recombinant Mouse PRKDC Protein, His (Fc)-Avi-tagged | +Inquiry |
PRKDC-6226C | Recombinant Chicken PRKDC | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRKDC Products
Required fields are marked with *
My Review for All PRKDC Products
Required fields are marked with *