Recombinant Human PRTN3 protein, His&Myc-tagged

Cat.No. : PRTN3-3376H
Product Overview : Recombinant Human PRTN3 protein(P24158)(28-248aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 28-248aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 31.7 kDa
AA Sequence : IVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLR
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name PRTN3 proteinase 3 [ Homo sapiens ]
Official Symbol PRTN3
Synonyms PRTN3; proteinase 3; myeloblastin; ACPA; AGP7; C ANCA; MBT; P29; PR 3; serine proteinase; neutrophil; Wegener granulomatosis autoantigen; NP-4; C-ANCA antigen; wegener autoantigen; leukocyte proteinase 3; neutrophil proteinase 4; azurophil granule protein 7; serine proteinase, neutrophil; MBN; NP4; PR3; PR-3; CANCA; C-ANCA;
Gene ID 5657
mRNA Refseq NM_002777
Protein Refseq NP_002768
MIM 177020
UniProt ID P24158

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRTN3 Products

Required fields are marked with *

My Review for All PRTN3 Products

Required fields are marked with *

0
cart-icon
0
compare icon