Recombinant Human PRTN3 protein, His&Myc-tagged
| Cat.No. : | PRTN3-3376H |
| Product Overview : | Recombinant Human PRTN3 protein(P24158)(28-248aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 28-248aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 31.7 kDa |
| AA Sequence : | IVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLR |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PRTN3 proteinase 3 [ Homo sapiens ] |
| Official Symbol | PRTN3 |
| Synonyms | PRTN3; proteinase 3; myeloblastin; ACPA; AGP7; C ANCA; MBT; P29; PR 3; serine proteinase; neutrophil; Wegener granulomatosis autoantigen; NP-4; C-ANCA antigen; wegener autoantigen; leukocyte proteinase 3; neutrophil proteinase 4; azurophil granule protein 7; serine proteinase, neutrophil; MBN; NP4; PR3; PR-3; CANCA; C-ANCA; |
| Gene ID | 5657 |
| mRNA Refseq | NM_002777 |
| Protein Refseq | NP_002768 |
| MIM | 177020 |
| UniProt ID | P24158 |
| ◆ Recombinant Proteins | ||
| Prtn3-6958M | Recombinant Mouse Prtn3 protein, His-tagged | +Inquiry |
| PRTN3-6020H | Recombinant Human PRTN3 Protein (Ile28-Arg249), N-GST tagged | +Inquiry |
| PRTN3-1556HFL | Recombinant Full Length Human PRTN3 Protein, C-Flag-tagged | +Inquiry |
| PRTN3-1996H | Recombinant Human PRTN3 Protein, His-tagged | +Inquiry |
| PRTN3-6019H | Recombinant Human PRTN3 Protein (Ala26-Arg249), C-His tagged | +Inquiry |
| ◆ Native Proteins | ||
| PRTN3-01H | Native Human PRTN3 Protein | +Inquiry |
| PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
| PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRTN3-2797HCL | Recombinant Human PRTN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRTN3 Products
Required fields are marked with *
My Review for All PRTN3 Products
Required fields are marked with *



