Recombinant Human PRTN3 protein, His-tagged
| Cat.No. : | PRTN3-45H |
| Product Overview : | Recombinant Human PRTN3 (Ala26-Arg249) fussed with His tag at C-terminal was expressed in HEK293 cells. |
| Availability | December 14, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 26-249 a.a. |
| Description : | Proteinase-3 is a neutral serine proteinase that belongs to the peptidase S1 family and Elastase subfamily. It contains one peptidase S1 domain and it is expressed mainly in neutrophil granulocytes. The primary function of Proteinase-3 is thought to be degradation of extracellular proteins at sites of inflammation, but excessive or prolonged proteolytic activity may cause harmful effects in the body. It is the epitope of anti-neutrophil cytoplasmic antibodies (ANCAs) of the cANCA (cytoplasmic subtype) class, a type of antibody frequently found in the disease Wegener's granulomatosis. |
| Form : | Supplied as a 0.2 μm filtered solution of 10mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 8.0 |
| AA Sequence : | AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNV RTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAM GWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFV IWGCATRLFPDFFTRVALYVDWIRSTLRRVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage : | Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles. |
| Gene Name | PRTN3 proteinase 3 [ Homo sapiens ] |
| Official Symbol | PRTN3 |
| Synonyms | MBN; MBT; NP4; P29; PR3; ACPA; AGP7; NP-4; PR-3; CANCA; C-ANCA; myeloblastin; C-ANCA antigen; Wegener granulomatosis autoantigen; azurophil granule protein 7; leukocyte proteinase 3; neutrophil proteinase 4; serine proteinase, neutrophil; wegener autoantigen |
| Gene ID | 5657 |
| mRNA Refseq | NM_002777 |
| Protein Refseq | NP_002768 |
| MIM | 177020 |
| UniProt ID | P24158 |
| Chromosome Location | 19p13.3 |
| Pathway | C-MYB transcription factor network, organism-specific biosystem; Common Pathway of Fibrin Clot Formation, organism-specific biosystem; Formation of Fibrin Clot (Clotting Cascade), organism-specific biosystem |
| Function | enzyme binding; serine-type endopeptidase activity; serine-type peptidase activity |
| ◆ Recombinant Proteins | ||
| PRTN3-2633H | Recombinant Human PRTN3 Protein, His-tagged | +Inquiry |
| PRTN3-45H | Recombinant Human PRTN3 protein, His-tagged | +Inquiry |
| PRTN3-7193M | Recombinant Mouse PRTN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRTN3-31105TH | Recombinant Human PRTN3 | +Inquiry |
| PRTN3-6019H | Recombinant Human PRTN3 Protein (Ala26-Arg249), C-His tagged | +Inquiry |
| ◆ Native Proteins | ||
| PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
| PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
| PRTN3-01H | Native Human PRTN3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRTN3-2797HCL | Recombinant Human PRTN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRTN3 Products
Required fields are marked with *
My Review for All PRTN3 Products
Required fields are marked with *
