Recombinant Human PRTN3 protein, His-tagged

Cat.No. : PRTN3-45H
Product Overview : Recombinant Human PRTN3 (Ala26-Arg249) fussed with His tag at C-terminal was expressed in HEK293 cells.
Availability October 05, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 26-249 a.a.
Description : Proteinase-3 is a neutral serine proteinase that belongs to the peptidase S1 family and Elastase subfamily. It contains one peptidase S1 domain and it is expressed mainly in neutrophil granulocytes. The primary function of Proteinase-3 is thought to be degradation of extracellular proteins at sites of inflammation, but excessive or prolonged proteolytic activity may cause harmful effects in the body. It is the epitope of anti-neutrophil cytoplasmic antibodies (ANCAs) of the cANCA (cytoplasmic subtype) class, a type of antibody frequently found in the disease Wegener's granulomatosis.
Form : Supplied as a 0.2 μm filtered solution of 10mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 8.0
AA Sequence : AEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNV RTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAM GWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFV IWGCATRLFPDFFTRVALYVDWIRSTLRRVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
Gene Name PRTN3 proteinase 3 [ Homo sapiens ]
Official Symbol PRTN3
Synonyms MBN; MBT; NP4; P29; PR3; ACPA; AGP7; NP-4; PR-3; CANCA; C-ANCA; myeloblastin; C-ANCA antigen; Wegener granulomatosis autoantigen; azurophil granule protein 7; leukocyte proteinase 3; neutrophil proteinase 4; serine proteinase, neutrophil; wegener autoantigen
Gene ID 5657
mRNA Refseq NM_002777
Protein Refseq NP_002768
MIM 177020
UniProt ID P24158
Chromosome Location 19p13.3
Pathway C-MYB transcription factor network, organism-specific biosystem; Common Pathway of Fibrin Clot Formation, organism-specific biosystem; Formation of Fibrin Clot (Clotting Cascade), organism-specific biosystem
Function enzyme binding; serine-type endopeptidase activity; serine-type peptidase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRTN3 Products

Required fields are marked with *

My Review for All PRTN3 Products

Required fields are marked with *

0
cart-icon
0
compare icon