Recombinant Human PTPN6 protein, His-tagged
| Cat.No. : | PTPN6-2501H |
| Product Overview : | Recombinant Human PTPN6 protein(506-598 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 506-598 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | QYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PTPN6 protein tyrosine phosphatase, non-receptor type 6 [ Homo sapiens ] |
| Official Symbol | PTPN6 |
| Synonyms | PTPN6; protein tyrosine phosphatase, non-receptor type 6; tyrosine-protein phosphatase non-receptor type 6; HCP; HCPH; PTP 1C; SHP 1; SHP1; hematopoietic cell phosphatase; protein-tyrosine phosphatase 1C; protein-tyrosine phosphatase SHP-1; hematopoietic cell protein-tyrosine phosphatase; SHP-1; HPTP1C; PTP-1C; SHP-1L; SH-PTP1; |
| Gene ID | 5777 |
| mRNA Refseq | NM_002831 |
| Protein Refseq | NP_002822 |
| MIM | 176883 |
| UniProt ID | P29350 |
| ◆ Recombinant Proteins | ||
| PTPN6-3129H | Recombinant Full Length Human PTPN6 Protein, MYC/DDK-tagged | +Inquiry |
| PTPN6-1360HFL | Recombinant Full Length Human PTPN6 Protein, C-Flag-tagged | +Inquiry |
| PTPN6-2576H | Recombinant Human PTPN6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PTPN6-1520H | Active Recombinant Full Length Human PTPN6 Protein, GST-tagged | +Inquiry |
| PTPN6-4494R | Recombinant Rat PTPN6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PTPN6-001MCL | Recombinant Mouse PTPN6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTPN6 Products
Required fields are marked with *
My Review for All PTPN6 Products
Required fields are marked with *



