Recombinant Human PTPN6 protein, His-tagged

Cat.No. : PTPN6-2501H
Product Overview : Recombinant Human PTPN6 protein(506-598 aa), fused to His tag, was expressed in E. coli.
Availability October 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 506-598 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : QYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PTPN6 protein tyrosine phosphatase, non-receptor type 6 [ Homo sapiens ]
Official Symbol PTPN6
Synonyms PTPN6; protein tyrosine phosphatase, non-receptor type 6; tyrosine-protein phosphatase non-receptor type 6; HCP; HCPH; PTP 1C; SHP 1; SHP1; hematopoietic cell phosphatase; protein-tyrosine phosphatase 1C; protein-tyrosine phosphatase SHP-1; hematopoietic cell protein-tyrosine phosphatase; SHP-1; HPTP1C; PTP-1C; SHP-1L; SH-PTP1;
Gene ID 5777
mRNA Refseq NM_002831
Protein Refseq NP_002822
MIM 176883
UniProt ID P29350

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTPN6 Products

Required fields are marked with *

My Review for All PTPN6 Products

Required fields are marked with *

0
cart-icon
0
compare icon