Recombinant Human PTPN6 protein, His-tagged
Cat.No. : | PTPN6-2501H |
Product Overview : | Recombinant Human PTPN6 protein(506-598 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 506-598 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QYKFIYVAIAQFIETTKKKLEVLQSQKGQESEYGNITYPPAMKNAHAKASRTSSKHKEDVYENLHTKNKREEKVKKQRSADKEKSKGSLKRK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PTPN6 protein tyrosine phosphatase, non-receptor type 6 [ Homo sapiens ] |
Official Symbol | PTPN6 |
Synonyms | PTPN6; protein tyrosine phosphatase, non-receptor type 6; tyrosine-protein phosphatase non-receptor type 6; HCP; HCPH; PTP 1C; SHP 1; SHP1; hematopoietic cell phosphatase; protein-tyrosine phosphatase 1C; protein-tyrosine phosphatase SHP-1; hematopoietic cell protein-tyrosine phosphatase; SHP-1; HPTP1C; PTP-1C; SHP-1L; SH-PTP1; |
Gene ID | 5777 |
mRNA Refseq | NM_002831 |
Protein Refseq | NP_002822 |
MIM | 176883 |
UniProt ID | P29350 |
◆ Recombinant Proteins | ||
PTPN6-0257M | Recombinant Mouse PTPN6 protein, His&GST-tagged | +Inquiry |
Ptpn6-8685M | Recombinant Mouse Ptpn6, His-GST tagged | +Inquiry |
Ptpn6-1102M | Recombinant Mouse Ptpn6 Protein, MYC/DDK-tagged | +Inquiry |
PTPN6-10326Z | Recombinant Zebrafish PTPN6 | +Inquiry |
PTPN6-5522H | Recombinant Human PTPN6 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPN6-001MCL | Recombinant Mouse PTPN6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTPN6 Products
Required fields are marked with *
My Review for All PTPN6 Products
Required fields are marked with *
0
Inquiry Basket