Recombinant Human SLC13A3 protein, GST-tagged

Cat.No. : SLC13A3-301399H
Product Overview : Recombinant Human SLC13A3 (568-602 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Gln568-Leu602
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : QTIFQLGTFPDWADMYSVNVTALPPTLANDTFRTL
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name SLC13A3 solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 [ Homo sapiens ]
Official Symbol SLC13A3
Synonyms SLC13A3; solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3; solute carrier family 13 member 3; NADC3; SDCT2; hNaDC3; naDC-3; Na(+)/dicarboxylate cotransporter 3; sodium-dependent high affinity dicarboxylate transporter 3; sodium-dependent high-affinity dicarboxylate transporter 2;
Gene ID 64849
mRNA Refseq NM_001011554
Protein Refseq NP_001011554
MIM 606411
UniProt ID Q8WWT9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC13A3 Products

Required fields are marked with *

My Review for All SLC13A3 Products

Required fields are marked with *

0
cart-icon
0
compare icon