Recombinant Human SLC13A3 protein, GST-tagged
Cat.No. : | SLC13A3-301399H |
Product Overview : | Recombinant Human SLC13A3 (568-602 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Gln568-Leu602 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | QTIFQLGTFPDWADMYSVNVTALPPTLANDTFRTL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SLC13A3 solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 [ Homo sapiens ] |
Official Symbol | SLC13A3 |
Synonyms | SLC13A3; solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3; solute carrier family 13 member 3; NADC3; SDCT2; hNaDC3; naDC-3; Na(+)/dicarboxylate cotransporter 3; sodium-dependent high affinity dicarboxylate transporter 3; sodium-dependent high-affinity dicarboxylate transporter 2; |
Gene ID | 64849 |
mRNA Refseq | NM_001011554 |
Protein Refseq | NP_001011554 |
MIM | 606411 |
UniProt ID | Q8WWT9 |
◆ Recombinant Proteins | ||
SLC13A3-6818HF | Recombinant Full Length Human SLC13A3 Protein, GST-tagged | +Inquiry |
SLC13A3-301259H | Recombinant Human SLC13A3 protein, GST-tagged | +Inquiry |
SLC13A3-672H | Recombinant Human SLC13A3 Protein, GST-tagged | +Inquiry |
SLC13A3-301399H | Recombinant Human SLC13A3 protein, GST-tagged | +Inquiry |
SLC13A3-12157Z | Recombinant Zebrafish SLC13A3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC13A3-1615HCL | Recombinant Human SLC13A3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC13A3 Products
Required fields are marked with *
My Review for All SLC13A3 Products
Required fields are marked with *