Recombinant Human TGFB1 protein, GST-tagged

• Cat.No.: TGFB1-7543H
• Product Overview: Recombinant Human TGFB1 protein(279-390 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Tag: GST
• Protein Length: 279-390 aa
• Tag: N-GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Gene Information

• Gene Name: TGFB1 transforming growth factor, beta 1 [ Homo sapiens ]
• Official Symbol: TGFB1
• Synonyms: TGFB1; transforming growth factor, beta 1; DPD1, TGFB; transforming growth factor beta-1; Camurati Engelmann disease; CED; TGFbeta; TGF-beta-1; TGF-beta 1 protein; latency-associated peptide; LAP; DPD1; TGFB
• Gene ID: 7040
• mRNA Refseq: NM_000660
• Protein Refseq: NP_000651
• MIM: 190180
• UniProt ID: P01137