"TIGIT" Related Products

Expand

Recombinant Human TIGIT Protein

Cat.No. : TIGIT-163H
Product Overview : Recombinant Human TIGIT was produced in E. coli.
Description : This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.
Source : E. coli
Species : Human
Form : Liquid. In 50 mM Tris-HCl pH7.5, 200 mM NaCl
Molecular Mass : (Theoretical molecular weight)~13kDa
AA sequence : HHHHHHSSGLVPRGSHMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLE
Purity : >90% as determined by SEC-HPLC
Storage : Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20~-80 centigrade. Avoid freeze/thaw cycles.
Concentration : 2 mg/ml
Figure :

Gene Name : TIGIT T cell immunoreceptor with Ig and ITIM domains [ Homo sapiens ]
Official Symbol : TIGIT
Synonyms : TIGIT; T cell immunoreceptor with Ig and ITIM domains; V set and immunoglobulin domain containing 9 , V set and transmembrane domain containing 3 , VSIG9, VSTM3; T-cell immunoreceptor with Ig and ITIM domains; DKFZp667A205; FLJ39873; V-set and transmembrane domain containing 3; V-set and immunoglobulin domain containing 9; Washington University cell adhesion molecule; V-set and transmembrane domain-containing protein 3; V-set and immunoglobulin domain-containing protein 9; VSIG9; VSTM3; WUCAM;
Gene ID : 201633
mRNA Refseq : NM_173799
Protein Refseq : NP_776160
MIM : 612859
UniProt ID : Q495A1

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.