Recombinant Human TIGIT Protein
Cat.No. : | TIGIT-163H |
Product Overview : | Recombinant Human TIGIT was produced in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses. |
Form : | Liquid. In 50 mM Tris-HCl pH7.5, 200 mM NaCl |
Molecular Mass : | (Theoretical molecular weight)~13kDa |
AA sequence : | HHHHHHSSGLVPRGSHMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLE |
Purity : | >90% as determined by SEC-HPLC |
Storage : | Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20~-80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 2 mg/ml |
Gene Name | TIGIT T cell immunoreceptor with Ig and ITIM domains [ Homo sapiens ] |
Official Symbol | TIGIT |
Synonyms | TIGIT; T cell immunoreceptor with Ig and ITIM domains; V set and immunoglobulin domain containing 9 , V set and transmembrane domain containing 3 , VSIG9, VSTM3; T-cell immunoreceptor with Ig and ITIM domains; DKFZp667A205; FLJ39873; V-set and transmembrane domain containing 3; V-set and immunoglobulin domain containing 9; Washington University cell adhesion molecule; V-set and transmembrane domain-containing protein 3; V-set and immunoglobulin domain-containing protein 9; VSIG9; VSTM3; WUCAM; |
Gene ID | 201633 |
mRNA Refseq | NM_173799 |
Protein Refseq | NP_776160 |
MIM | 612859 |
UniProt ID | Q495A1 |
◆ Recombinant Proteins | ||
TIGIT-564H | Recombinant Human TIGIT protein, His-Myc-tagged | +Inquiry |
TIGIT-725C | Recombinant Cynomolgus monkey TIGIT Protein | +Inquiry |
TIGIT-135H | Recombinant Human TIGIT protein, T7/His-tagged | +Inquiry |
TIGIT-5738H | Recombinant Human TIGIT Protein (Met22-Pro141), C-His tagged | +Inquiry |
TIGIT-1297M | Acitve Recombinant Mouse TIGIT protein(Met1-Gly141), mFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIGIT-1420MCL | Recombinant Mouse TIGIT cell lysate | +Inquiry |
TIGIT-2610HCL | Recombinant Human TIGIT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TIGIT Products
Required fields are marked with *
My Review for All TIGIT Products
Required fields are marked with *
0
Inquiry Basket