Cat.No. :	TIGIT-163H
Product Overview :	Recombinant Human TIGIT was produced in E. coli.
Description :	This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.
Source :	E. coli
Species :	Human
Form :	Liquid. In 50 mM Tris-HCl pH7.5, 200 mM NaCl
Molecular Mass :	(Theoretical molecular weight)~13kDa
AA sequence :	HHHHHHSSGLVPRGSHMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLE
Purity :	>90% as determined by SEC-HPLC
Storage :	Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20~-80 centigrade. Avoid freeze/thaw cycles.
Concentration :	2 mg/ml
Figure :

Gene Name :	TIGIT T cell immunoreceptor with Ig and ITIM domains [ Homo sapiens ]
Official Symbol :	TIGIT
Synonyms :	TIGIT; T cell immunoreceptor with Ig and ITIM domains; V set and immunoglobulin domain containing 9 , V set and transmembrane domain containing 3 , VSIG9, VSTM3; T-cell immunoreceptor with Ig and ITIM domains; DKFZp667A205; FLJ39873; V-set and transmembrane domain containing 3; V-set and immunoglobulin domain containing 9; Washington University cell adhesion molecule; V-set and transmembrane domain-containing protein 3; V-set and immunoglobulin domain-containing protein 9; VSIG9; VSTM3; WUCAM;
Gene ID :	201633
mRNA Refseq :	NM_173799
Protein Refseq :	NP_776160
MIM :	612859
UniProt ID :	Q495A1

Online Inquiry