Cat.No.:	TIGIT-163H
Product Overview:	Recombinant Human TIGIT was produced in E. coli.
Description:	This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.
Source:	E. coli
Species:	Human
Form:	Liquid. In 50 mM Tris-HCl pH7.5, 200 mM NaCl
Molecular Mass:	(Theoretical molecular weight)~13kDa
AA sequence:	HHHHHHSSGLVPRGSHMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLE
Purity:	>90% as determined by SEC-HPLC
Storage:	Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20~-80 centigrade. Avoid freeze/thaw cycles.
Concentration:	2 mg/ml

Gene Name:	TIGIT T cell immunoreceptor with Ig and ITIM domains [ Homo sapiens ]
Official Symbol:	TIGIT
Synonyms:	TIGIT; T cell immunoreceptor with Ig and ITIM domains; V set and immunoglobulin domain containing 9 , V set and transmembrane domain containing 3 , VSIG9, VSTM3; T-cell immunoreceptor with Ig and ITIM domains; DKFZp667A205; FLJ39873; V-set and transmembrane domain containing 3; V-set and immunoglobulin domain containing 9; Washington University cell adhesion molecule; V-set and transmembrane domain-containing protein 3; V-set and immunoglobulin domain-containing protein 9; VSIG9; VSTM3; WUCAM;
Gene ID:	201633
mRNA Refseq:	NM_173799
Protein Refseq:	NP_776160
MIM:	612859
UniProt ID:	Q495A1

Online Inquiry