"TIGIT" Related Products

Expand
Expand
Expand

Recombinant Human TIGIT Protein

Cat.No.: TIGIT-163H
Product Overview: Recombinant Human TIGIT was produced in E. coli.
Description: This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.
Source: E. coli
Species: Human
Form: Liquid. In 50 mM Tris-HCl pH7.5, 200 mM NaCl
Molecular Mass: (Theoretical molecular weight)~13kDa
AA sequence: HHHHHHSSGLVPRGSHMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLE
Purity: >90% as determined by SEC-HPLC
Storage: Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20~-80 centigrade. Avoid freeze/thaw cycles.
Concentration: 2 mg/ml
Gene Name: TIGIT T cell immunoreceptor with Ig and ITIM domains [ Homo sapiens ]
Official Symbol: TIGIT
Synonyms: TIGIT; T cell immunoreceptor with Ig and ITIM domains; V set and immunoglobulin domain containing 9 , V set and transmembrane domain containing 3 , VSIG9, VSTM3; T-cell immunoreceptor with Ig and ITIM domains; DKFZp667A205; FLJ39873; V-set and transmembrane domain containing 3; V-set and immunoglobulin domain containing 9; Washington University cell adhesion molecule; V-set and transmembrane domain-containing protein 3; V-set and immunoglobulin domain-containing protein 9; VSIG9; VSTM3; WUCAM;
Gene ID: 201633
mRNA Refseq: NM_173799
Protein Refseq: NP_776160
MIM: 612859
UniProt ID: Q495A1

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.