Recombinant Human TIGIT Protein

• Cat.No.: TIGIT-163H
• Product Overview: Recombinant Human TIGIT was produced in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.
• Form: Liquid. In 50 mM Tris-HCl pH7.5, 200 mM NaCl
• Molecular Mass: (Theoretical molecular weight)~13kDa
• AA sequence: HHHHHHSSGLVPRGSHMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLE
• Purity: >90% as determined by SEC-HPLC
• Storage: Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20~-80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 2 mg/ml

Gene Information

• Gene Name: TIGIT T cell immunoreceptor with Ig and ITIM domains [ Homo sapiens ]
• Official Symbol: TIGIT
• Synonyms: TIGIT; T cell immunoreceptor with Ig and ITIM domains; V set and immunoglobulin domain containing 9 , V set and transmembrane domain containing 3 , VSIG9, VSTM3; T-cell immunoreceptor with Ig and ITIM domains; DKFZp667A205; FLJ39873; V-set and transmembrane domain containing 3; V-set and immunoglobulin domain containing 9; Washington University cell adhesion molecule; V-set and transmembrane domain-containing protein 3; V-set and immunoglobulin domain-containing protein 9; VSIG9; VSTM3; WUCAM
• Gene ID: 201633
• mRNA Refseq: NM_173799
• Protein Refseq: NP_776160
• MIM: 612859
• UniProt ID: Q495A1