Recombinant Human TNFRSF1A, Fc-tagged therapeutic protein(Etanercept)
Cat.No. : | TNFR-P002H |
Product Overview : | Dimeric fusion protein consisting of the extracellular ligand-binding portion of the human 75 kilodalton (p75) tumor necrosis factor receptor (TNFR) linked to the Fc portion of human IgG1. The Fc component of the protein contains the CH2 domain, the CH3 domain and hinge region, but not the CH1 domain of IgG1. The therapeutic protein is produced by recombinant DNA technology in a Chinese hamster ovary (CHO) mammalian cell expression system. It consists of 934 amino acids. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | Fc |
Protein Length : | 467 Aa |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways. The expression product is the active ingredient of Enbrel and Enbrel Sureclick.The therapeutic protein treats autoimmune diseases by interfering with tumornecrosis factor (TNF; a soluble inflammatorycytokine) by acting as a TNF inhibitor. It is alarge molecule, with a molecular weight of 150 kDa.,that binds to TNFα and decreases its role in disorders involving excessinflammation in humans and other animals, including autoimmunediseases such as ankylosingspondylitis, juvenilerheumatoid arthritis, psoriasis, psoriaticarthritis, rheumatoidarthritis, and, potentially, in a variety of other disorders mediated byexcess TNFα. |
Molecular Mass : | 51.2 Kda |
AA Sequence : | LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPEC LSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPC APGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPST APSTSFLLPMGPSPPAEGSTGDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVV DVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Alias : | TNFRSF1A; FPF; p55; p60; TBP1; TNF-R; p55-R TNFR55; TNF-R-I; TNF-R55; Etanercept; etanercept-szzs;etanercept-ykro; Recombinant human TNF; rhu TNFR:Fc; rhu-TNFR:Fc; TNFR-Immunoadhesin |
Gene Name | TNFRSF1A tumor necrosis factor receptor superfamily, member 1A [ Homo sapiens ] |
Official Symbol | TNFRSF1A |
Synonyms | TNFRSF1A; tumor necrosis factor receptor superfamily, member 1A; TNFR1; tumor necrosis factor receptor superfamily member 1A; CD120a; TNF R; TNF R I; TNF R55; TNFAR; TNFR60; TNF-R1; TNF-RI; TNFR-I; tumor necrosis factor-alpha receptor; tumor necrosis factor receptor type 1; tumor necrosis factor binding protein 1; tumor necrosis factor receptor 1A isoform beta; FPF; p55; p60; TBP1; TNF-R; p55-R; TNFR55; TNF-R-I; TNF-R55; MGC19588; |
Gene ID | 7132 |
mRNA Refseq | NM_001065 |
Protein Refseq | NP_001056 |
MIM | 191190 |
UniProt ID | P19438 |
Chromosome Location | 12p13.2 |
Pathway | Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; Apoptosis, organism-specific biosystem; |
Function | protease binding; protein binding; receptor activity; tumor necrosis factor binding; tumor necrosis factor-activated receptor activity; |
◆ Recombinant Proteins | ||
TNFRSF1A-31571TH | Recombinant Human TNFRSF1A, His-tagged | +Inquiry |
TNFRSF1A-141H | Recombinant Human TNFRSF1A Protein, His-tagged | +Inquiry |
TNFRSF1A-248H | Recombinant Human TNFRSF1A protein | +Inquiry |
TNFRSF1A-6197R | Recombinant Rat TNFRSF1A Protein | +Inquiry |
TNFRSF1A-660H | Recombinant Human tumor necrosis factor receptor superfamily, member 1A, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF1A-1693MCL | Recombinant Mouse TNFRSF1A cell lysate | +Inquiry |
TNFRSF1A-1084RCL | Recombinant Rat TNFRSF1A cell lysate | +Inquiry |
TNFRSF1A-2390HCL | Recombinant Human TNFRSF1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF1A Products
Required fields are marked with *
My Review for All TNFRSF1A Products
Required fields are marked with *