| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
Fc |
| Description : |
Predicted to enable MHC class II protein complex binding activity and protein homodimerization activity. Involved in learning or memory; modulation of age-related behavioral decline; and negative regulation of cell differentiation. Acts upstream of or within several processes, including antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent; cellular response to iron(III) ion; and protein refolding. Located in external side of plasma membrane. Is expressed in several structures, including central nervous system; early conceptus; genitourinary system; hemolymphoid system gland; and retina. Used to study hemochromatosis and type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in arthritis; familial visceral amyloidosis; immunodeficiency 43; and inflammatory bowel disease. |
| Form : |
50mM Tris, 300mM NaCl, pH 8.5. |
| Molecular Mass : |
37.1 kDa |
| AA Sequence : |
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM |
| Purity : |
> 90% |
| Storage : |
Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : |
0.19mg/ml |
