Recombinant Mouse B2M Protein, Fc-tagged
Cat.No. : | B2M-01M |
Product Overview : | Recombinant Mouse B2M Protein, fused to Fc-tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Fc |
Description : | Predicted to enable MHC class II protein complex binding activity and protein homodimerization activity. Involved in learning or memory; modulation of age-related behavioral decline; and negative regulation of cell differentiation. Acts upstream of or within several processes, including antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent; cellular response to iron(III) ion; and protein refolding. Located in external side of plasma membrane. Is expressed in several structures, including central nervous system; early conceptus; genitourinary system; hemolymphoid system gland; and retina. Used to study hemochromatosis and type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in arthritis; familial visceral amyloidosis; immunodeficiency 43; and inflammatory bowel disease. |
Form : | 50mM Tris, 300mM NaCl, pH 8.5. |
Molecular Mass : | 37.1 kDa |
AA Sequence : | DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM |
Purity : | > 90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.19mg/ml |
Gene Name | B2m beta-2 microglobulin [ Mus musculus (house mouse) ] |
Official Symbol | B2m |
Synonyms | Ly-m11; beta2m; beta2-m |
Gene ID | 12010 |
mRNA Refseq | NM_009735 |
Protein Refseq | NP_033865 |
UniProt ID | P01887 |
◆ Recombinant Proteins | ||
B2m-01H | Recombinant mouse beta-2 microglobulin protein, Fc-tagged | +Inquiry |
B2M-104H | Recombinant Human B2M Protein, His-tagged | +Inquiry |
B2M-002H | Recombinant Human B2M protein, GST-tagged | +Inquiry |
B2m-533G | Recombinant Golden hamster B2m protein | +Inquiry |
B2M-76H | Recombinant Human B2M, His-tagged | +Inquiry |
◆ Native Proteins | ||
B2M-13H | Native Human B2M | +Inquiry |
B2M-8046H | Native Human Beta 2 MicroGlobulin | +Inquiry |
B2M-5366H | Native Human Beta-2-Microglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
B2M-2204HCL | Recombinant Human B2M cell lysate | +Inquiry |
B2M-1512CCL | Recombinant Cynomolgus B2M cell lysate | +Inquiry |
B2M-1550RCL | Recombinant Rat B2M cell lysate | +Inquiry |
B2M-1656MCL | Recombinant Mouse B2M cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B2M Products
Required fields are marked with *
My Review for All B2M Products
Required fields are marked with *