Recombinant Mouse B2M Protein, Fc-tagged

Cat.No. : B2M-01M
Product Overview : Recombinant Mouse B2M Protein, fused to Fc-tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Fc
Description : Predicted to enable MHC class II protein complex binding activity and protein homodimerization activity. Involved in learning or memory; modulation of age-related behavioral decline; and negative regulation of cell differentiation. Acts upstream of or within several processes, including antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent; cellular response to iron(III) ion; and protein refolding. Located in external side of plasma membrane. Is expressed in several structures, including central nervous system; early conceptus; genitourinary system; hemolymphoid system gland; and retina. Used to study hemochromatosis and type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in arthritis; familial visceral amyloidosis; immunodeficiency 43; and inflammatory bowel disease.
Form : 50mM Tris, 300mM NaCl, pH 8.5.
Molecular Mass : 37.1 kDa
AA Sequence : DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM
Purity : > 90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.19mg/ml
Gene Name B2m beta-2 microglobulin [ Mus musculus (house mouse) ]
Official Symbol B2m
Synonyms Ly-m11; beta2m; beta2-m
Gene ID 12010
mRNA Refseq NM_009735
Protein Refseq NP_033865
UniProt ID P01887

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All B2M Products

Required fields are marked with *

My Review for All B2M Products

Required fields are marked with *

0
cart-icon