Recombinant mouse beta-2 microglobulin protein, Fc-tagged
Cat.No. : | B2m-01H |
Product Overview : | Recombinant mouse beta-2 microglobulin protein with N-terminal Fc fusion tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Fc |
Protein Length : | 326 |
Description : | Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system. |
Form : | Buffered aqueous solution |
Molecular Mass : | 37.1 kDa |
AA Sequence : | DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM |
Purity : | >90% by SDS-PAGE |
Applications : | Antigen for antibody production ELISA Kinetics |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.19 mg/ml |
Storage Buffer : | Solution in 50mM Tris-HCl, 300mM NaCl, pH 8.5. |
Gene Name | B2m |
Official Symbol | B2m |
Synonyms | Ly-m11, beta 2 microglobulin, beta2-m |
Gene ID | 12010 |
mRNA Refseq | NM_009735.3 |
Protein Refseq | NP_033865.2 |
UniProt ID | P01887 |
◆ Recombinant Proteins | ||
B2M-011H | Recombinant Hamster beta 2 microglobulin Protein, His tagged | +Inquiry |
B2M-002H | Recombinant Human B2M protein, GST-tagged | +Inquiry |
B2M-01M | Recombinant Mouse B2M Protein, Fc-tagged | +Inquiry |
B2M-206H | Recombinant Human B2M Protein | +Inquiry |
B2M-0235H | Recombinant Human B2M Protein (Met1-Met119), Tag Free | +Inquiry |
◆ Native Proteins | ||
B2M-8046H | Native Human Beta 2 MicroGlobulin | +Inquiry |
B2M-5366H | Native Human Beta-2-Microglobulin | +Inquiry |
B2M-13H | Native Human B2M | +Inquiry |
◆ Cell & Tissue Lysates | ||
B2M-1550RCL | Recombinant Rat B2M cell lysate | +Inquiry |
B2M-1512CCL | Recombinant Cynomolgus B2M cell lysate | +Inquiry |
B2M-2204HCL | Recombinant Human B2M cell lysate | +Inquiry |
B2M-1656MCL | Recombinant Mouse B2M cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B2m Products
Required fields are marked with *
My Review for All B2m Products
Required fields are marked with *