Recombinant mouse beta-2 microglobulin protein, Fc-tagged

Cat.No. : B2m-01H
Product Overview : Recombinant mouse beta-2 microglobulin protein with N-terminal Fc fusion tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Fc
Protein Length : 326
Description : Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system.
Form : Buffered aqueous solution
Molecular Mass : 37.1 kDa
AA Sequence : DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM
Purity : >90% by SDS-PAGE
Applications : Antigen for antibody production
ELISA
Kinetics
Storage : Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.19 mg/ml
Storage Buffer : Solution in 50mM Tris-HCl, 300mM NaCl, pH 8.5.
Gene Name B2m
Official Symbol B2m
Synonyms Ly-m11, beta 2 microglobulin, beta2-m
Gene ID 12010
mRNA Refseq NM_009735.3
Protein Refseq NP_033865.2
UniProt ID P01887

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All B2m Products

Required fields are marked with *

My Review for All B2m Products

Required fields are marked with *

0

Inquiry Basket

cartIcon