Recombinant Mouse CD40 Protein
Cat.No. : | CD40-630M |
Product Overview : | Recombinant Mouse CD40 protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Protein Length : | 289 |
Description : | Predicted to enable antigen binding activity; protein domain specific binding activity; and ubiquitin protein ligase binding activity. Involved in B cell mediated immunity; CD40 signaling pathway; and cellular calcium ion homeostasis. Acts upstream of or within several processes, including defense response to other organism; positive regulation of B cell activation; and positive regulation of interleukin-12 production. Located in external side of plasma membrane and intracellular membrane-bounded organelle. Part of CD40 receptor complex. Is expressed in several structures, including alimentary system; brain; hemolymphoid system gland; liver and biliary system; and reproductive system. Human ortholog(s) of this gene implicated in several diseases, including Kawasaki disease; autoimmune disease (multiple); end stage renal disease; hyperimmunoglobulin syndrome (multiple); and non-Hodgkin lymphoma (multiple). Orthologous to human CD40 (CD40 molecule). |
Form : | Lyophilized |
Molecular Mass : | 20.8 kDa |
AA Sequence : | MVSLPRLCALWGCLLTAVHLGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRALLVIPVVMGILITIFGVFLYIKKVVKKPKDNEILPPAARRQDPQEMEDYPGHNTAAPVQETLHGCQPVTQEDGKESRISVQERQVTDSIALRPLV |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Cd40 CD40 antigen [ Mus musculus (house mouse) ] |
Official Symbol | CD40 |
Synonyms | CD40; CD40 antigen; tumor necrosis factor receptor superfamily member 5; CD40L receptor; B-cell surface antigen CD40; T-cell differentiation antigen; tumor necrosis factor receptor superfamily, member 5; IGM; p50; Bp50; GP39; IMD3; TRAP; HIGM1; T-BAM; Tnfrsf5; AI326936; |
Gene ID | 21939 |
mRNA Refseq | NM_011611 |
Protein Refseq | NP_035741 |
UniProt ID | P27512 |
◆ Recombinant Proteins | ||
Cd40-8727RAF555 | Recombinant Rat Cd40 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
CD40-0812H | Recombinant Human CD40 Protein, GST-Tagged | +Inquiry |
CD40-85C | Recombinant Cynomolgus CD40 protein, His-tagged | +Inquiry |
CD40-153CF | Recombinant Canine CD40 Protein, LEVLFQ-tagged, FITC conjugated | +Inquiry |
CD40-2964HF | Recombinant Full Length Human CD40 Protein, GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD40-001CCL | Recombinant Canine CD40 cell lysate | +Inquiry |
CD40-1262RCL | Recombinant Rat CD40 cell lysate | +Inquiry |
CD40-2617HCL | Recombinant Human CD40 cell lysate | +Inquiry |
CD40-1831MCL | Recombinant Mouse CD40 cell lysate | +Inquiry |
CD40-1254CCL | Recombinant Cynomolgus CD40 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD40 Products
Required fields are marked with *
My Review for All CD40 Products
Required fields are marked with *
0
Inquiry Basket