Recombinant Mouse CD40 Protein

Cat.No. : CD40-630M
Product Overview : Recombinant Mouse CD40 protein without tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Protein Length : 289
Description : Predicted to enable antigen binding activity; protein domain specific binding activity; and ubiquitin protein ligase binding activity. Involved in B cell mediated immunity; CD40 signaling pathway; and cellular calcium ion homeostasis. Acts upstream of or within several processes, including defense response to other organism; positive regulation of B cell activation; and positive regulation of interleukin-12 production. Located in external side of plasma membrane and intracellular membrane-bounded organelle. Part of CD40 receptor complex. Is expressed in several structures, including alimentary system; brain; hemolymphoid system gland; liver and biliary system; and reproductive system. Human ortholog(s) of this gene implicated in several diseases, including Kawasaki disease; autoimmune disease (multiple); end stage renal disease; hyperimmunoglobulin syndrome (multiple); and non-Hodgkin lymphoma (multiple). Orthologous to human CD40 (CD40 molecule).
Form : Lyophilized
Molecular Mass : 20.8 kDa
AA Sequence : MVSLPRLCALWGCLLTAVHLGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRALLVIPVVMGILITIFGVFLYIKKVVKKPKDNEILPPAARRQDPQEMEDYPGHNTAAPVQETLHGCQPVTQEDGKESRISVQERQVTDSIALRPLV
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Cd40 CD40 antigen [ Mus musculus (house mouse) ]
Official Symbol CD40
Synonyms CD40; CD40 antigen; tumor necrosis factor receptor superfamily member 5; CD40L receptor; B-cell surface antigen CD40; T-cell differentiation antigen; tumor necrosis factor receptor superfamily, member 5; IGM; p50; Bp50; GP39; IMD3; TRAP; HIGM1; T-BAM; Tnfrsf5; AI326936;
Gene ID 21939
mRNA Refseq NM_011611
Protein Refseq NP_035741
UniProt ID P27512

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD40 Products

Required fields are marked with *

My Review for All CD40 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon