Recombinant Mouse CXCL2 Protein

Cat.No. : CXCL2-65M
Product Overview : Recombinant Mouse CXCL2 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Macrophage Inflammatory Protein 2 (MIP-2), also known as CXCL2, is a small cytokine that is secreted by monocytes and neutrophils at sites of inflammation. MIP-2 functions through the chemokine receptor CXCR2 to act as a chemotactic agent for leukocytes and hematopoietic cells.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 7.9 kDa (73 aa)
AA Sequence : AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Cxcl2 chemokine (C-X-C motif) ligand 2 [ Mus musculus (house mouse) ]
Official Symbol CXCL2
Synonyms CXCL2; chemokine (C-X-C motif) ligand 2; C-X-C motif chemokine 2; macrophage inflammatory protein 2; small inducible cytokine subfamily, member 2; GROb; Gro2; Mip2; Scyb; MIP-2; Scyb2; MIP-2a; Mgsa-b; CINC-2a;
Gene ID 20310
mRNA Refseq NM_009140
Protein Refseq NP_033166
UniProt ID P10889

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL2 Products

Required fields are marked with *

My Review for All CXCL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon