Recombinant Mouse CXCL2 Protein
| Cat.No. : | CXCL2-65M |
| Product Overview : | Recombinant Mouse CXCL2 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Description : | Macrophage Inflammatory Protein 2 (MIP-2), also known as CXCL2, is a small cytokine that is secreted by monocytes and neutrophils at sites of inflammation. MIP-2 functions through the chemokine receptor CXCR2 to act as a chemotactic agent for leukocytes and hematopoietic cells. |
| Bio-activity : | No biological activity data is available at this time. |
| Molecular Mass : | Monomer, 7.9 kDa (73 aa) |
| AA Sequence : | AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN |
| Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
| Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : | Storage Prior to Reconstitution: -20 centigrade |
| Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
| Reconstitution : | Sterile water at 0.1 mg/mL |
| Shipping : | Room temperature |
| Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
| Gene Name | Cxcl2 chemokine (C-X-C motif) ligand 2 [ Mus musculus (house mouse) ] |
| Official Symbol | CXCL2 |
| Synonyms | CXCL2; chemokine (C-X-C motif) ligand 2; C-X-C motif chemokine 2; macrophage inflammatory protein 2; small inducible cytokine subfamily, member 2; GROb; Gro2; Mip2; Scyb; MIP-2; Scyb2; MIP-2a; Mgsa-b; CINC-2a; |
| Gene ID | 20310 |
| mRNA Refseq | NM_009140 |
| Protein Refseq | NP_033166 |
| UniProt ID | P10889 |
| ◆ Recombinant Proteins | ||
| CXCL2-64H | Recombinant Human CXCL2 Protein | +Inquiry |
| CXCL2-2165P | Recombinant CXCL2 Protein, His-Flag-StrepII-tagged | +Inquiry |
| Cxcl2-328C | Active Recombinant Mouse Cxcl2 Protein (73 aa) | +Inquiry |
| Cxcl2-020C | Active Recombinant Mouse Cxcl2 Protein (73 aa) | +Inquiry |
| CXCL2-17H | Active Recombinant Human CXCL2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CXCL2-7168HCL | Recombinant Human CXCL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL2 Products
Required fields are marked with *
My Review for All CXCL2 Products
Required fields are marked with *
