Recombinant Mouse MERTK protein(19-497aa), His-tagged
Cat.No. : | MERTK-0515M |
Product Overview : | Recombinant Mouse MERTK protein(Q60805)(19-497aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Protein Length : | 19-497 a.a. |
Form : | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Mouse Mertk at 2 μg/mL can bind anti-MERTK recombinant antibody, the EC50 is 19.22-25.80 ng/mL. |
Molecular Mass : | 55.0 kDa |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GGTAEKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSM |
Gene Name | Mertk c-mer proto-oncogene tyrosine kinase [ Mus musculus ] |
Official Symbol | MERTK |
Synonyms | MERTK; c-mer proto-oncogene tyrosine kinase; tyrosine-protein kinase Mer; Tyro 12; proto-oncogene c-Mer; receptor tyrosine kinase MerTK; proto-oncogene tyrosine-protein kinase Mer; Eyk; Mer; Nyk; nmf12; |
Gene ID | 17289 |
mRNA Refseq | NM_008587 |
Protein Refseq | NP_032613 |
◆ Recombinant Proteins | ||
MERTK-3903H | Recombinant Human MERTK Protein (Leu587-Leu858), N-His tagged | +Inquiry |
MERTK-900HFL | Recombinant Full Length Human MERTK Protein, C-Flag-tagged | +Inquiry |
MERTK-148H | Recombinant Human MERTK protein | +Inquiry |
Mertk-001D | Recombinant Dog MERTK protein, GST-tagged | +Inquiry |
MERTK-03H | Recombinant Human MERTK Protein, hFc-Avi tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
MERTK-2888HCL | Recombinant Human MERTK cell lysate | +Inquiry |
MERTK-001HCL | Recombinant Human MERTK cell lysate | +Inquiry |
MERTK-1816MCL | Recombinant Mouse MERTK cell lysate | +Inquiry |
MERTK-484HCL | Recombinant Human MERTK cell lysate | +Inquiry |
MERTK-413MCL | Recombinant Mouse MERTK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MERTK Products
Required fields are marked with *
My Review for All MERTK Products
Required fields are marked with *
0
Inquiry Basket