Recombinant Mouse MERTK protein(19-497aa), His-tagged
| Cat.No. : | MERTK-0515M |
| Product Overview : | Recombinant Mouse MERTK protein(Q60805)(19-497aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 19-497 a.a. |
| Form : | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Mouse Mertk at 2 μg/mL can bind anti-MERTK recombinant antibody, the EC50 is 19.22-25.80 ng/mL. |
| Molecular Mass : | 55.0 kDa |
| Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GGTAEKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSM |
| Gene Name | Mertk c-mer proto-oncogene tyrosine kinase [ Mus musculus ] |
| Official Symbol | MERTK |
| Synonyms | MERTK; c-mer proto-oncogene tyrosine kinase; tyrosine-protein kinase Mer; Tyro 12; proto-oncogene c-Mer; receptor tyrosine kinase MerTK; proto-oncogene tyrosine-protein kinase Mer; Eyk; Mer; Nyk; nmf12; |
| Gene ID | 17289 |
| mRNA Refseq | NM_008587 |
| Protein Refseq | NP_032613 |
| ◆ Recombinant Proteins | ||
| MERTK-950H | Recombinant Human MERTK Protein, MYC/DDK-tagged | +Inquiry |
| MERTK-4437H | Active Recombinant Human MERTK Protein, GST-tagged | +Inquiry |
| MERTK-2194M | Recombinant Mouse MERTK protein, Fc-tagged | +Inquiry |
| MERTK-149H | Recombinant Human MERTK protein, His-tagged | +Inquiry |
| MERTK-3902H | Recombinant Human MERTK Protein (Arg21-Ala494), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MERTK-504HKCL | Human MERTK Knockdown Cell Lysate | +Inquiry |
| MERTK-484HCL | Recombinant Human MERTK cell lysate | +Inquiry |
| MERTK-001HCL | Recombinant Human MERTK cell lysate | +Inquiry |
| MERTK-1816MCL | Recombinant Mouse MERTK cell lysate | +Inquiry |
| MERTK-413MCL | Recombinant Mouse MERTK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MERTK Products
Required fields are marked with *
My Review for All MERTK Products
Required fields are marked with *


