Recombinant Rat Ciliary Neurotrophic Factor

Cat.No. : Cntf-296R
Product Overview : Recombinant Rat Cntf produced inE.Coliis a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Description : CNTF is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. In addition to the predominant monocistronic transcript originating from this locus, the gene is also co-transcribed with the upstream ZFP91 gene. Co-transcription from the two loci results in a transcript that contains a complete coding region for the zinc finger protein but lacks a complete coding region for ciliary neurotrophic factor. CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.
Amino Acid Sequence : AFAEQTPLTLHRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVD GVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQ AIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLK VLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
Purity : Greater than 99.0% as determined by: (a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.
Physical Appearance : Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation : Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3.
Solubility : It is recommended to reconstitute the lyophilized CNTF in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.
Protein content : CNTF quantitation was carried out by two independent methods: 1. UV spectroscopy at 280 nm using the absorbency value of 1.22 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a standard solution of CNTF Recombinant as a Reference Standard.
Stability : Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18℃. Upon reconstitution CNTF should be stored at 4℃ between 2-7 days and for future use below -18℃. Please prevent freeze-thaw cycles.
Gene Name Cntf ciliary neurotrophic factor [ Mus musculus ]
Synonyms Cntf; ciliary neurotrophic factor; AI429687; MGC41235; OTTMUSP00000029848
Gene ID 12803
mRNA Refseq NM_170786
Protein Refseq NP_740756
UniProt ID P51642
Chromosome Location 19 7.0 cM
Pathway Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway
Function growth factor activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cntf Products

Required fields are marked with *

My Review for All Cntf Products

Required fields are marked with *

0
cart-icon
0
compare icon