Recombinant Rat TGFA protein, His-KSI-tagged
| Cat.No. : | TGFA-655R |
| Product Overview : | Recombinant Rat TGFA protein(P01134)(24-159aa), fused with N-terminal His and KSI tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&KSI |
| Protein Length : | 24-159aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.1 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | ENSTSPLSDSPVAAAVVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALVCRHEKPSALLKGRTACCHSETVV |
| Gene Name | Tgfa transforming growth factor alpha [ Rattus norvegicus ] |
| Official Symbol | TGFA |
| Synonyms | TGFA; transforming growth factor alpha; protransforming growth factor alpha; TGFAA; RATTGFAA; |
| Gene ID | 24827 |
| mRNA Refseq | NM_012671 |
| Protein Refseq | NP_036803 |
| ◆ Recombinant Proteins | ||
| TGFA-1538S | Recombinant Sheep TGFA Protein (24-97 aa), GST-tagged | +Inquiry |
| RFL34251MF | Recombinant Full Length Macaca Mulatta (Rhesus Macaque) Protransforming Growth Factor Alpha(Tgfa) Protein, His-Tagged | +Inquiry |
| TGFA-297H | Recombinant Active Human TGFA Protein, His-tagged(C-ter) | +Inquiry |
| TGFA-3208H | Recombinant Human TGFA, GST-tagged | +Inquiry |
| TGFa-149H | Active Recombinant Human TGFA protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TGFA-1121HCL | Recombinant Human TGFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFA Products
Required fields are marked with *
My Review for All TGFA Products
Required fields are marked with *



