Recombinant Rat TGFA protein, His-KSI-tagged
Cat.No. : | TGFA-655R |
Product Overview : | Recombinant Rat TGFA protein(P01134)(24-159aa), fused with N-terminal His and KSI tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 24-159aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ENSTSPLSDSPVAAAVVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALVCRHEKPSALLKGRTACCHSETVV |
Gene Name | Tgfa transforming growth factor alpha [ Rattus norvegicus ] |
Official Symbol | TGFA |
Synonyms | TGFA; transforming growth factor alpha; protransforming growth factor alpha; TGFAA; RATTGFAA; |
Gene ID | 24827 |
mRNA Refseq | NM_012671 |
Protein Refseq | NP_036803 |
◆ Recombinant Proteins | ||
TGFA-6426H | Recombinant Human TGFA Protein (Val40-Ala89), N-GST tagged | +Inquiry |
TGFA-1538S | Recombinant Sheep TGFA Protein (24-97 aa), GST-tagged | +Inquiry |
TGFA-5692R | Recombinant Rat TGFA Protein, His (Fc)-Avi-tagged | +Inquiry |
TGFA-2763H | Recombinant Human TGFA Protein, His-tagged | +Inquiry |
Tgfa-2126M | Recombinant Mouse Tgfa Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TGFA-29704TH | Recombinant Human TGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFA-1121HCL | Recombinant Human TGFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFA Products
Required fields are marked with *
My Review for All TGFA Products
Required fields are marked with *