Recombinant Sheep TGFA Protein (24-97 aa), GST-tagged
| Cat.No. : | TGFA-828S |
| Product Overview : | Recombinant Sheep TGFA Protein (24-97 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Sheep |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 24-97 aa |
| Description : | TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor/EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 34.9 kDa |
| AA Sequence : | ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| UniProt ID | P98135 |
| ◆ Recombinant Proteins | ||
| TGFA-285H | Active Recombinant Human TGFA Protein (Trp40-Ala89), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| TGFA-538H | Active Recombinant Human TGFA | +Inquiry |
| TGFA-828S | Recombinant Sheep TGFA Protein (24-97 aa), GST-tagged | +Inquiry |
| TGFA-1538S | Recombinant Sheep TGFA Protein (24-97 aa), GST-tagged | +Inquiry |
| TGFA-2127R | Recombinant Rabbit TGFA Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TGFA-1121HCL | Recombinant Human TGFA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TGFA Products
Required fields are marked with *
My Review for All TGFA Products
Required fields are marked with *
