Active Recombinant Canine interleukin 17A protein, His tagged
| Cat.No. : | IL17A-12C |
| Product Overview : | Recombinant canine IL-17A (29-155 aa), fused to Histag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques. |
| Availability | December 24, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Canine |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 29-155 aa |
| Description : | This gene is a member of the IL-17 receptor family which includes five members (IL-17RA-E) and the encoded protein is a proinflammatory cytokine produced by activated T cells. IL-17A-mediated downstream pathways induce the production of inflammatory molecules, chemokines, antimicrobial peptides, and remodeling proteins. The encoded protein elicits crucial impacts on host defense, cell trafficking, immune modulation, and tissue repair, with a key role in the induction of innate immune defenses. This cytokine stimulates non-hematopoietic cells and promotes chemokine production thereby attracting myeloid cells to inflammatory sites. This cytokine also regulates the activities of NF-kappaB and mitogen-activated protein kinases and can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). IL-17A plays a pivotal role in various infectious diseases, inflammatory and autoimmune disorders, and cancer. High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The lung damage induced by the severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is to a large extent, a result of the inflammatory response promoted by cytokines such as IL17A. |
| Tag : | His |
| Form : | Liquid |
| Bio-activity : | The activity is determined by the IL-6 ELISA in a using NIH/3T3 mouse embryonic fibroblast cells. The ED50 range ≤ 10 ng/mL. |
| Molecular Mass : | 15.6 kDa (133aa) |
| AA Sequence : | FPQNPGCRNTEDKNFPQHVKVNLNILNRNTNSRRPSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNNEGNINYHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHVA |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Applications : | SDS-PAGE, Bioactivity |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Storage Buffer : | In Phosphate-Buffered Saline (pH 7.4) containing 20% glycerol. |
| Concentration : | 0.5 mg/mL (determined by Absorbance at 280nm) |
| Reference : | 1. Moseley TA., et al, (2003) Cytokine & Growth Factor Reviews. 14: 155-174. 2. Afzali, B. et al. (2007) Clin. Exp. Immunol. 148:32-46. 3. Fossiez, F. et al. (1996) J. Exp. Med. 183:2593-2603. |
| Gene Name | IL17A interleukin 17A [ Canis lupus familiaris (dog) ] |
| Official Symbol | IL17A |
| Synonyms | IL17A; interleukin 17A; interleukin-17A |
| Gene ID | 481837 |
| mRNA Refseq | NM_001165878 |
| Protein Refseq | NP_001159350 |
| UniProt ID | C6L8D7 |
| ◆ Recombinant Proteins | ||
| Il17a-01M | Active Recombinant Mouse Il17a Protein, His-Tagged | +Inquiry |
| IL17A-5856H | Recombinant Human IL17A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| IL17A-432P | Recombinant Pig IL17A protein, His&Myc-tagged | +Inquiry |
| IL17A-056C | Recombinant Cynomolgus IL17A protein, His-Avi-tagged | +Inquiry |
| IL17A-236B | Recombinant Bovine Interleukin 17A | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL17A Products
Required fields are marked with *
My Review for All IL17A Products
Required fields are marked with *
