Active Recombinant Canine interleukin 17A protein, His tagged

Cat.No. : IL17A-12C
Product Overview : Recombinant canine IL-17A (29-155 aa), fused to Histag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
Availability December 18, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Canine
Source : HEK293
Tag : His
Protein Length : 29-155 aa
Description : This gene is a member of the IL-17 receptor family which includes five members (IL-17RA-E) and the encoded protein is a proinflammatory cytokine produced by activated T cells. IL-17A-mediated downstream pathways induce the production of inflammatory molecules, chemokines, antimicrobial peptides, and remodeling proteins. The encoded protein elicits crucial impacts on host defense, cell trafficking, immune modulation, and tissue repair, with a key role in the induction of innate immune defenses. This cytokine stimulates non-hematopoietic cells and promotes chemokine production thereby attracting myeloid cells to inflammatory sites. This cytokine also regulates the activities of NF-kappaB and mitogen-activated protein kinases and can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). IL-17A plays a pivotal role in various infectious diseases, inflammatory and autoimmune disorders, and cancer. High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The lung damage induced by the severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is to a large extent, a result of the inflammatory response promoted by cytokines such as IL17A.
Tag : His
Form : Liquid
Bio-activity : The activity is determined by the IL-6 ELISA in a using NIH/3T3 mouse embryonic fibroblast cells. The ED50 range ≤ 10 ng/mL.
Molecular Mass : 15.6 kDa (133aa)
AA Sequence : FPQNPGCRNTEDKNFPQHVKVNLNILNRNTNSRRPSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNNEGNINYHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHVA
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Storage Buffer : In Phosphate-Buffered Saline (pH 7.4) containing 20% glycerol.
Concentration : 0.5 mg/mL (determined by Absorbance at 280nm)
Reference : 1. Moseley TA., et al, (2003) Cytokine & Growth Factor Reviews. 14: 155-174.
2. Afzali, B. et al. (2007) Clin. Exp. Immunol. 148:32-46.
3. Fossiez, F. et al. (1996) J. Exp. Med. 183:2593-2603.
Gene Name IL17A interleukin 17A [ Canis lupus familiaris (dog) ]
Official Symbol IL17A
Synonyms IL17A; interleukin 17A; interleukin-17A
Gene ID 481837
mRNA Refseq NM_001165878
Protein Refseq NP_001159350
UniProt ID C6L8D7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL17A Products

Required fields are marked with *

My Review for All IL17A Products

Required fields are marked with *

0
cart-icon
0
compare icon