Active Recombinant Human TDGF1, Fc Chimera

Cat.No. : TDGF1-496H
Product Overview : Recombinant Human Teratocarcinoma-Derived Growth Factor 1 encoding the signal peptide and extracellular domain of human Cripto-1 (aa 1-169) was fused to the Fc region of human IgG1 (aa 90-330). The chimeric protein was expressed in modifiedhuman 293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Description : Cripto-1 (CR-1), also known as teratocarcinoma-derived growth factor-1 (TDGF-1), is a small glycoprotein that contains a single divergent EGF-like motif as well as a novel cysteine-rich domain termed the Cripto motif. It is the founding member of the EGF-CFC gene family, which is conserved among vertebrates, with homologs in chick, frogs, and zebrafish.
Amino Acid Sequence : LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCM LGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPG CDGLVMDEHLVASRTPELPPSGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPGK.
Molecular Mass : Under reducing conditions Cripto-1 – Fc Chimera migrates as a broad band between 45 and 55 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified Cripto-1 - Fc Chimera that has a predicted monomeric molecular mass of 42.8 kDa.
pI : Cripto-1 – Fc Chimera separates into a number of glycoforms with an observed pI between 6.5 and 10 on 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified Cripto-1 - Fc Chimera that has a predicted pI of 8.2.
% Carbohydrate : Purified Cripto-1 – Fc Chimera consists of 5-30% carbohydrate by weight.
Glycosylation : Cripto-1 – Fc Chimera contains N-linked and O-linked oligosaccharides.
Purity : >95%, as determined by SDS-PAGE and visualized by Coomassie Briliant Blue.
Formulation : When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution : It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage : Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Activity : 200 ng/ml Cripto-1 – Fc Chimera induces ERK1 and ERK2 phosphorylation in human umbilical vein endothelial (HUVEC) cells
Gene Name TDGF1 teratocarcinoma-derived growth factor 1 [ Homo sapiens ]
Synonyms TDGF1; teratocarcinoma-derived growth factor 1; CR; CRGF; CRIPTO; Cripto-1; Epidermal growth factor-like cripto protein CR1; Cripto-1 growth factor
Gene ID 6997
mRNA Refseq NM_003212
Protein Refseq NP_003203
UniProt ID P13385
Chromosome Location 3p21.31
MIM 187395
Function growth factor activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TDGF1 Products

Required fields are marked with *

My Review for All TDGF1 Products

Required fields are marked with *

0
cart-icon
0
compare icon