Active Recombinant Human TDGF1, Fc Chimera
Cat.No. : | TDGF1-496H |
Product Overview : | Recombinant Human Teratocarcinoma-Derived Growth Factor 1 encoding the signal peptide and extracellular domain of human Cripto-1 (aa 1-169) was fused to the Fc region of human IgG1 (aa 90-330). The chimeric protein was expressed in modifiedhuman 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Description : | Cripto-1 (CR-1), also known as teratocarcinoma-derived growth factor-1 (TDGF-1), is a small glycoprotein that contains a single divergent EGF-like motif as well as a novel cysteine-rich domain termed the Cripto motif. It is the founding member of the EGF-CFC gene family, which is conserved among vertebrates, with homologs in chick, frogs, and zebrafish. |
Amino Acid Sequence : | LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCM LGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPG CDGLVMDEHLVASRTPELPPSGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPGK. |
Molecular Mass : | Under reducing conditions Cripto-1 – Fc Chimera migrates as a broad band between 45 and 55 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified Cripto-1 - Fc Chimera that has a predicted monomeric molecular mass of 42.8 kDa. |
pI : | Cripto-1 – Fc Chimera separates into a number of glycoforms with an observed pI between 6.5 and 10 on 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified Cripto-1 - Fc Chimera that has a predicted pI of 8.2. |
% Carbohydrate : | Purified Cripto-1 – Fc Chimera consists of 5-30% carbohydrate by weight. |
Glycosylation : | Cripto-1 – Fc Chimera contains N-linked and O-linked oligosaccharides. |
Purity : | >95%, as determined by SDS-PAGE and visualized by Coomassie Briliant Blue. |
Formulation : | When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
Reconstitution : | It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
Storage : | Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended. |
Activity : | 200 ng/ml Cripto-1 – Fc Chimera induces ERK1 and ERK2 phosphorylation in human umbilical vein endothelial (HUVEC) cells |
Gene Name | TDGF1 teratocarcinoma-derived growth factor 1 [ Homo sapiens ] |
Synonyms | TDGF1; teratocarcinoma-derived growth factor 1; CR; CRGF; CRIPTO; Cripto-1; Epidermal growth factor-like cripto protein CR1; Cripto-1 growth factor |
Gene ID | 6997 |
mRNA Refseq | NM_003212 |
Protein Refseq | NP_003203 |
UniProt ID | P13385 |
Chromosome Location | 3p21.31 |
MIM | 187395 |
Function | growth factor activity |
◆ Recombinant Proteins | ||
TDGF1-2904H | Recombinant Human TDGF1, MBP | +Inquiry |
TDGF1-3556H | Recombinant Human TDGF1 protein, GST-tagged | +Inquiry |
TDGF1-166R | Recombinant Rat Tdgf1, His tagged | +Inquiry |
TDGF1-3170H | Recombinant Human TDGF1, GST-tagged | +Inquiry |
TDGF1-573H | Active Recombinant Human TDGF1 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TDGF1-2432HCL | Recombinant Human TDGF1 cell lysate | +Inquiry |
TDGF1-832RCL | Recombinant Rat TDGF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TDGF1 Products
Required fields are marked with *
My Review for All TDGF1 Products
Required fields are marked with *
0
Inquiry Basket