Active Recombinant Mouse Il25 Protein

• Cat.No.: Il25-5210M
• Product Overview: Mouse Il25 (Q8VHC9) recombinant protein expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Description: Interleukin-25 (IL-25) – also known as interleukin-17E (IL-17E) – is a protein that in humans is encoded by the IL25 gene.
• Form: Lyophilized
• Bio-activity: The activity is determined by the dose-dependant production of IL-8 by human PBMCs. The expected ED50 for this effect is 322-488 ng/mL.
• Molecular Mass: 35.5 kDa
• AA Sequence: MVSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA
• Endotoxin: < 0.1 EU/μg
• Applications: Functional Study
  SDS-PAGE
• Storage: Store at -20 centigrade on dry atmosphere. After reconstitution with sterilized water, store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: No additive

Gene Information

• Gene Name: Il25 interleukin 25 [ Mus musculus ]
• Official Symbol: Il25
• Synonyms: IL25; interleukin 25; interleukin-25; interleukin 17E; Il17e; IL-17e
• Gene ID: 140806
• mRNA Refseq: NM_080729
• Protein Refseq: NP_542767