Active Recombinant Rat IL25 Protein
Cat.No. : | IL25-5209R |
Product Overview : | Rat IL25 recombinant protein expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Description : | The protein encoded by this gene is a cytokine that shares the sequence similarity with IL17. This cytokine can induce NF-kappaB activation, and stimulate the production of IL8. Both this cytokine and IL17B are ligands for the cytokine receptor IL17BR. Studies of the similar gene in mice suggested that this cytokine may be a proinflammatory cytokine favoring Th2-type immune response. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq |
Form : | Lyophilized |
Bio-activity : | The activity is determined by the dose-dependent induction of human IL-8 production from human PBMCs. The expected ED50 for this effect is 25-37.5 ng/mL. |
Molecular Mass : | 35.5 kDa |
AA Sequence : | MCSHLPRCCPSKQQEFPEEWLKWNPAPVSPPEPLRHTHHPESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPMGNSVPLYHNQTVFYRRPCHGEQGAHGRYCLERRLYRVSLACVCVRPRMMA |
Endotoxin : | < 0.1 EU/μg |
Applications : | Functional Study SDS-PAGE |
Storage : | Store at -20 centigrade on dry atmosphere. After reconstitution with sterilized 20 mM HCl, store at -20 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | No additive |
Gene Name | Il25 interleukin 25 [ Rattus norvegicus ] |
Official Symbol | IL25 |
Synonyms | IL25; interleukin 25; interleukin-25; RGD1561632; |
Gene ID | 501996 |
mRNA Refseq | NM_001192007 |
Protein Refseq | NP_001178936 |
◆ Recombinant Proteins | ||
IL25-182H | Recombinant Active Human IL25 Protein, His-tagged(C-ter) | +Inquiry |
IL25-151H | Recombinant Human IL25 Protein, His-tagged | +Inquiry |
Il25-199M | Recombinant Mouse Interleukin 25 | +Inquiry |
IL25-495R | Active Recombinant Rat Interleukin-17E (IL-25) | +Inquiry |
Il25-1011M | Recombinant Mouse Il25 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL25-2920HCL | Recombinant Human IL25 cell lysate | +Inquiry |
IL25-2910MCL | Recombinant Mouse IL25 cell lysate | +Inquiry |
IL25-1261RCL | Recombinant Rat IL25 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL25 Products
Required fields are marked with *
My Review for All IL25 Products
Required fields are marked with *