Recombinant Mouse Interleukin 25
Cat.No. : | Il25-199M |
Product Overview : | Recombinant Mouse IL17E produced inE.Coliis a homodimeric, non-glycosylated polypeptide chain containing a total of 306 amino acids and having a molecular mass of 34.9 kDa. The Mouse IL-17E is purified by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Description : | IL-25 also called IL-17E cytokine has a sequence similarity with IL17. IL-17E indluces NF-kappaB activation, and stimulates the production of IL-8. IL17E and IL17B are ligands for the cytokine receptor IL17BR. IL-25 is a proinflammatory cytokine favoring Th2-type immune response. The upregulation of costimulation-induced IL-17E receptors and release of cytokines and chemokines from IL-17E treated costimulated Th cells are differentially regulated by intracellular JNK, p38 MAPK and NF-kappaB activity. Blocking Iinterleukin-25 prevents airway hyperresponsiveness, a critical feature of clinical asthma. IL25 produced by innate effector eosinophils and basophils increase the allergic inflammation by enhancing the maintenance and functions of TSLP-DC activated adaptive Th2 memory cells. Over expression of IL-25 up-regulates gene expression of Th2 cytokines and induces growth retardation, jaundice, and multiorgan inflammation in a transgenic mouse model. IL-25 contributes to the induction and maintenance of eosinophilic inflammation by acting on lung fibroblasts which supports the fact that IL-17E is an important factor in asthma pathophysiology. IL-17E operates by amplifying TH2 cell-mediated allergic airway inflammation but doesn't induce allergic inflammation in vivo. |
Amino Acid Sequence : | VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAIS PWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHM DPLGNSVPLYH NQTV FY RRPCHGEEGTHRRYCLERRLYRVSLACVCVRP RVMA. |
Purity : | Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Formulation : | IL17E was lyophilized from a concentrated (1mg/ml) solution containing no additives. |
Solubility : | It is recommended to reconstitute the lyophilized Mouse IL17E in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Stability : | Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Gene Name | Il25 interleukin 25 [ Mus musculus ] |
Synonyms | Il25; interleukin 25; Il17e; IL-17E |
Gene ID | 140806 |
mRNA Refseq | NM_080729 |
Protein Refseq | NP_542767 |
UniProt ID | Q8VHC9 |
Chromosome Location | 14 C3 |
Pathway | Cytokine-cytokine receptor interaction |
Function | cytokine activity;interleukin-17E receptor binding |
◆ Recombinant Proteins | ||
Il25-1813M | Recombinant Mouse Il25 protein, His & GST-tagged | +Inquiry |
IL25-140H | Recombinant Human Interleukin 25 | +Inquiry |
Il25-1010M | Active Recombinant Mouse Il25 Protein | +Inquiry |
IL25-509H | Recombinant Human IL25 Protein | +Inquiry |
IL25-3616H | Recombinant Human IL25 Protein (Met28-Gly177), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL25-2910MCL | Recombinant Mouse IL25 cell lysate | +Inquiry |
IL25-1261RCL | Recombinant Rat IL25 cell lysate | +Inquiry |
IL25-2920HCL | Recombinant Human IL25 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il25 Products
Required fields are marked with *
My Review for All Il25 Products
Required fields are marked with *
0
Inquiry Basket