"TDGF1" Related Products

Expand

Recombinant Human TDGF1, Fc Chimera

Cat. No.: TDGF1-496H
Product Overview: Recombinant Human Teratocarcinoma-Derived Growth Factor 1 encoding the signal peptide and extracellular domain of human Cripto-1 (aa 1-169) was fused to the Fc region of human IgG1 (aa 90-330). The chimeric protein was expressed in modifiedhuman 293 cells.
Description: Cripto-1 (CR-1), also known as teratocarcinoma-derived growth factor-1 (TDGF-1), is a small glycoprotein that contains a single divergent EGF-like motif as well as a novel cysteine-rich domain termed the Cripto motif. It is the founding member of the EGF-CFC gene family, which is conserved among vertebrates, with homologs in chick, frogs, and zebrafish.
Source: Human 293 cells.
Amino Acid Sequence: LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCM LGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPG CDGLVMDEHLVASRTPELPPSGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPGK.
Molecular Mass: Under reducing conditions Cripto-1 – Fc Chimera migrates as a broad band between 45 and 55 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified Cripto-1 - Fc Chimera that has a predicted monomeric molecular mass of 42.8 kDa.
pI: Cripto-1 – Fc Chimera separates into a number of glycoforms with an observed pI between 6.5 and 10 on 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified Cripto-1 - Fc Chimera that has a predicted pI of 8.2.
% Carbohydrate: Purified Cripto-1 – Fc Chimera consists of 5-30% carbohydrate by weight.
Glycosylation: Cripto-1 – Fc Chimera contains N-linked and O-linked oligosaccharides.
Purity: >95%, as determined by SDS-PAGE and visualized by Coomassie Briliant Blue.
Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Activity: 200 ng/ml Cripto-1 – Fc Chimera induces ERK1 and ERK2 phosphorylation in human umbilical vein endothelial (HUVEC) cells
Gene Name: TDGF1 teratocarcinoma-derived growth factor 1 [ Homo sapiens ]
Synonyms: TDGF1; teratocarcinoma-derived growth factor 1; CR; CRGF; CRIPTO; Cripto-1; Epidermal growth factor-like cripto protein CR1; Cripto-1 growth factor
Gene ID: 6997
mRNA Refseq: NM_003212
Protein Refseq: NP_003203
UniProt ID: P13385
Chromosome Location: 3p21.31
MIM: 187395
Function: growth factor activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.