"TDGF1" Related Products

Expand

Recombinant Human TDGF1, Fc Chimera

Cat. No.: TDGF1-496H
Product Overview: Recombinant Human Teratocarcinoma-Derived Growth Factor 1 encoding the signal peptide and extracellular domain of human Cripto-1 (aa 1-169) was fused to the Fc region of human IgG1 (aa 90-330). The chimeric protein was expressed in modifiedhuman 293 cells.
Description: Cripto-1 (CR-1), also known as teratocarcinoma-derived growth factor-1 (TDGF-1), is a small glycoprotein that contains a single divergent EGF-like motif as well as a novel cysteine-rich domain termed the Cripto motif. It is the founding member of the EGF-CFC gene family, which is conserved among vertebrates, with homologs in chick, frogs, and zebrafish.
Source: Human 293 cells.
Amino Acid Sequence: LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCM LGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPG CDGLVMDEHLVASRTPELPPSGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH EALHNHYTQKSLSLSPGK.
Molecular Mass: Under reducing conditions Cripto-1 – Fc Chimera migrates as a broad band between 45 and 55 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified Cripto-1 - Fc Chimera that has a predicted monomeric molecular mass of 42.8 kDa.
pI: Cripto-1 – Fc Chimera separates into a number of glycoforms with an observed pI between 6.5 and 10 on 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified Cripto-1 - Fc Chimera that has a predicted pI of 8.2.
% Carbohydrate: Purified Cripto-1 – Fc Chimera consists of 5-30% carbohydrate by weight.
Glycosylation: Cripto-1 – Fc Chimera contains N-linked and O-linked oligosaccharides.
Purity: >95%, as determined by SDS-PAGE and visualized by Coomassie Briliant Blue.
Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Activity: 200 ng/ml Cripto-1 – Fc Chimera induces ERK1 and ERK2 phosphorylation in human umbilical vein endothelial (HUVEC) cells
Gene Name: TDGF1 teratocarcinoma-derived growth factor 1 [ Homo sapiens ]
Synonyms: TDGF1; teratocarcinoma-derived growth factor 1; CR; CRGF; CRIPTO; Cripto-1; Epidermal growth factor-like cripto protein CR1; Cripto-1 growth factor
Gene ID: 6997
mRNA Refseq: NM_003212
Protein Refseq: NP_003203
UniProt ID: P13385
Chromosome Location: 3p21.31
MIM: 187395
Function: growth factor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.