Recombinant Mouse Interleukin 25

Cat.No. : Il25-199M
Product Overview : Recombinant Mouse IL17E produced inE.Coliis a homodimeric, non-glycosylated polypeptide chain containing a total of 306 amino acids and having a molecular mass of 34.9 kDa. The Mouse IL-17E is purified by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Description : IL-25 also called IL-17E cytokine has a sequence similarity with IL17. IL-17E indluces NF-kappaB activation, and stimulates the production of IL-8. IL17E and IL17B are ligands for the cytokine receptor IL17BR. IL-25 is a proinflammatory cytokine favoring Th2-type immune response. The upregulation of costimulation-induced IL-17E receptors and release of cytokines and chemokines from IL-17E treated costimulated Th cells are differentially regulated by intracellular JNK, p38 MAPK and NF-kappaB activity. Blocking Iinterleukin-25 prevents airway hyperresponsiveness, a critical feature of clinical asthma. IL25 produced by innate effector eosinophils and basophils increase the allergic inflammation by enhancing the maintenance and functions of TSLP-DC activated adaptive Th2 memory cells. Over expression of IL-25 up-regulates gene expression of Th2 cytokines and induces growth retardation, jaundice, and multiorgan inflammation in a transgenic mouse model. IL-25 contributes to the induction and maintenance of eosinophilic inflammation by acting on lung fibroblasts which supports the fact that IL-17E is an important factor in asthma pathophysiology. IL-17E operates by amplifying TH2 cell-mediated allergic airway inflammation but doesn't induce allergic inflammation in vivo.
Amino Acid Sequence : VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAIS PWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHM DPLGNSVPLYH NQTV FY RRPCHGEEGTHRRYCLERRLYRVSLACVCVRP RVMA.
Purity : Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Formulation : IL17E was lyophilized from a concentrated (1mg/ml) solution containing no additives.
Solubility : It is recommended to reconstitute the lyophilized Mouse IL17E in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Stability : Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Gene Name Il25 interleukin 25 [ Mus musculus ]
Synonyms Il25; interleukin 25; Il17e; IL-17E
Gene ID 140806
mRNA Refseq NM_080729
Protein Refseq NP_542767
UniProt ID Q8VHC9
Chromosome Location 14 C3
Pathway Cytokine-cytokine receptor interaction
Function cytokine activity;interleukin-17E receptor binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il25 Products

Required fields are marked with *

My Review for All Il25 Products

Required fields are marked with *

0
cart-icon
0
compare icon