Recombinant Human SAA1

• Cat.No.: SAA1-31162TH
• Product Overview: Recombinant Full Length Human Serum Amyloid A produced in Saccharomyces cerevisiae; 122 amino acids, 11.7 kDa. Protein is tagged with 26 kDa proprietary tag.

Specification

• Description: This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimers disease and Crohn s disease. This protein may also be a potential biomarker for certain tumors. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11.
• Tissue specificity: Expressed by the liver; secreted in plasma.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYS DMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISD ARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPA GLPEKY
• Sequence Similarities: Belongs to the SAA family.

Gene Information

• Gene Name: SAA1 serum amyloid A1 [ Homo sapiens ]
• Official Symbol: SAA1
• Synonyms: SAA1; serum amyloid A1; SAA; serum amyloid A protein; PIG4; TP53I4
• Gene ID: 6288
• mRNA Refseq: NM_000331
• Protein Refseq: NP_000322
• MIM: 104750
• Uniprot ID: P02735
• Chromosome Location: 11p15.1
• Pathway: Activated TLR4 signalling, organism-specific biosystem; Advanced glycosylation endproduct receptor signaling, organism-specific biosystem; Amyloids, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Folate Metabolism, organism-specific biosystem
• Function: G-protein coupled receptor binding