Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human SAA1

Cat.No. : SAA1-31162TH
Product Overview : Recombinant Full Length Human Serum Amyloid A produced in Saccharomyces cerevisiae; 122 amino acids, 11.7 kDa. Protein is tagged with 26 kDa proprietary tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimers disease and Crohn s disease. This protein may also be a potential biomarker for certain tumors. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11.
Tissue specificity : Expressed by the liver; secreted in plasma.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYS DMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISD ARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPA GLPEKY
Sequence Similarities : Belongs to the SAA family.
Gene Name : SAA1 serum amyloid A1 [ Homo sapiens ]
Official Symbol : SAA1
Synonyms : SAA1; serum amyloid A1; SAA; serum amyloid A protein; PIG4; TP53I4;
Gene ID : 6288
mRNA Refseq : NM_000331
Protein Refseq : NP_000322
MIM : 104750
Uniprot ID : P02735
Chromosome Location : 11p15.1
Pathway : Activated TLR4 signalling, organism-specific biosystem; Advanced glycosylation endproduct receptor signaling, organism-specific biosystem; Amyloids, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Folate Metabolism, organism-specific biosystem;
Function : G-protein coupled receptor binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends