Recombinant Human SAA1

Cat.No. : SAA1-31162TH
Product Overview : Recombinant Full Length Human Serum Amyloid A produced in Saccharomyces cerevisiae; 122 amino acids, 11.7 kDa. Protein is tagged with 26 kDa proprietary tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded protein is a major acute phase protein that is highly expressed in response to inflammation and tissue injury. This protein also plays an important role in HDL metabolism and cholesterol homeostasis. High levels of this protein are associated with chronic inflammatory diseases including atherosclerosis, rheumatoid arthritis, Alzheimers disease and Crohn s disease. This protein may also be a potential biomarker for certain tumors. Alternate splicing results in multiple transcript variants that encode the same protein. A pseudogene of this gene is found on chromosome 11.
Tissue specificity : Expressed by the liver; secreted in plasma.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYS DMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISD ARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPA GLPEKY
Sequence Similarities : Belongs to the SAA family.
Gene Name : SAA1 serum amyloid A1 [ Homo sapiens ]
Official Symbol : SAA1
Synonyms : SAA1; serum amyloid A1; SAA; serum amyloid A protein; PIG4; TP53I4;
Gene ID : 6288
mRNA Refseq : NM_000331
Protein Refseq : NP_000322
MIM : 104750
Uniprot ID : P02735
Chromosome Location : 11p15.1
Pathway : Activated TLR4 signalling, organism-specific biosystem; Advanced glycosylation endproduct receptor signaling, organism-specific biosystem; Amyloids, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Folate Metabolism, organism-specific biosystem;
Function : G-protein coupled receptor binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (7)

Ask a question
Are there specific stimuli or triggers that induce the expression and secretion of SAA1, influencing its role in the acute-phase response? 11/24/2021

Specific stimuli or triggers, such as infection or tissue damage, induce the expression and secretion of SAA1, influencing its role in the acute-phase response.

What diseases or conditions are associated with dysregulation or abnormal expression of SAA1, especially in the context of inflammatory disorders? 12/15/2020

Dysregulation or abnormal expression of SAA1 is associated with various inflammatory disorders, including rheumatoid arthritis and atherosclerosis.

In which cellular compartments is SAA1 predominantly synthesized and secreted? 10/05/2020

SAA1 is predominantly synthesized in the liver and secreted into the bloodstream, serving as a major acute-phase protein.

What is the primary role of Serum Amyloid A1 (SAA1) in cellular processes and acute-phase responses? 09/10/2017

Serum Amyloid A1 (SAA1) plays a crucial role in cellular processes, primarily contributing to acute-phase responses and inflammatory reactions.

How does SAA1 contribute to inflammation, particularly in the context of acute-phase reactions? 02/26/2017

SAA1 contributes to inflammation by actively participating in acute-phase reactions, amplifying the immune response during various challenges.

Are there therapeutic implications or potential targets related to SAA1 in diseases involving acute-phase responses and chronic inflammation? 01/21/2017

There are potential therapeutic implications related to SAA1 in diseases involving acute-phase responses and chronic inflammation, making it a target for drug development.

How does SAA1 participate in modulating immune responses and influencing the progression of inflammatory conditions? 03/05/2016

SAA1 actively modulates immune responses, influencing the progression of inflammatory conditions and contributing to tissue repair.

Customer Reviews (3)

Write a review
Reviews
06/05/2022

    Gel electrophoresis consistently displayed well-defined bands, affirming the product's purity and reliability.

    09/21/2018

      The product's manufacturer went above and beyond to ensure our satisfaction, strengthening our trust in the brand.

      09/15/2018

        The value derived from the product's usage made the investment worthwhile, considering the insights acquired.

        Ask a Question for All SAA1 Products

        Required fields are marked with *

        My Review for All SAA1 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /
        • Service lnquiry:

        Stay Updated on the Latest Bioscience Trends