Recombinant Rat Bglap Protein, GST-tagged

Cat.No. : Bglap-1143R
Product Overview : Recombinant Rat Bglap Protein (50-99aa) was expressed in E. coli with N-terminal GST-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : GST
Protein Length : 50-99 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 32.6 kDa
AA Sequence : YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Bglap Bone gamma-carboxyglutamate protein [ Rattus norvegicus ]
Official Symbol Bglap
Synonyms BGLAP; Bone gamma-carboxyglutamate protein
Gene ID 25295
mRNA Refseq NM_013414
Protein Refseq NP_038200
UniProt ID P04640

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Bglap Products

Required fields are marked with *

My Review for All Bglap Products

Required fields are marked with *

0

Inquiry Basket

cartIcon