Recombinant Rat Bglap Protein, GST-tagged

• Cat.No.: Bglap-1143R
• Product Overview: Recombinant Rat Bglap Protein (50-99aa) was expressed in E. coli with N-terminal GST-tag.

Specification

• Species: Rat
• Source: E.coli
• Tag: GST
• Protein Length: 50-99 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 32.6 kDa
• AA Sequence: YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: Bglap Bone gamma-carboxyglutamate protein [ Rattus norvegicus ]
• Official Symbol: Bglap
• Synonyms: BGLAP; Bone gamma-carboxyglutamate protein
• Gene ID: 25295
• mRNA Refseq: NM_013414
• Protein Refseq: NP_038200
• UniProt ID: P04640