Recombinant Full Length Human CX3CR1 Protein, GST-tagged

Cat.No. : CX3CR1-2222HF
Product Overview : Human CX3CR1 full-length ORF ( AAH28078.1, 1 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 355 amino acids
Description : Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]
Molecular Mass : 64.79 kDa
AA Sequence : MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CX3CR1 chemokine (C-X3-C motif) receptor 1 [ Homo sapiens ]
Official Symbol CX3CR1
Synonyms CX3CR1; chemokine (C-X3-C motif) receptor 1; chemokine (C X3 C) receptor 1 , CMKBRL1, GPR13; CX3C chemokine receptor 1; CCRL1; CMKDR1; V28; CMK-BRL1; CMK-BRL-1; C-X3-C CKR-1; fractalkine receptor; G protein-coupled receptor 13; G-protein coupled receptor 13; chemokine (C-X3-C) receptor 1; beta chemokine receptor-like 1; chemokine (C-C) receptor-like 1; GPR13; GPRV28; CMKBRL1
Gene ID 1524
mRNA Refseq NM_001171171
Protein Refseq NP_001164642
MIM 601470
UniProt ID P49238

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CX3CR1 Products

Required fields are marked with *

My Review for All CX3CR1 Products

Required fields are marked with *

0
cart-icon