Recombinant Human AP3B1 protein, GST-tagged

Cat.No. : AP3B1-655H
Product Overview : Human AP3B1 partial ORF ( NP_003655, 995 a.a. - 1094 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. The encoded protein is part of the heterotetrameric AP-3 protein complex which interacts with the scaffolding protein clathrin. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 2. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2012]
Molecular Mass : 36.74 kDa
AA Sequence : KEQGVLTGMNETSAVIIAAPQNFTPSVIFQKVVNVANVGAVPSGQDNIHRFAAKTVHSGSLMLVTVELKEGSTAQLIINTEKTVIGSVLLRELKPVLSQG
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AP3B1 adaptor-related protein complex 3, beta 1 subunit [ Homo sapiens ]
Official Symbol AP3B1
Synonyms AP3B1; adaptor-related protein complex 3, beta 1 subunit; AP-3 complex subunit beta-1; ADTB3A; HPS2; beta3A-adaptin; beta-3A-adaptin; AP-3 complex beta-3A subunit; adaptor protein complex AP-3 subunit beta-1; adapter-related protein complex 3 subunit beta-1; clathrin assembly protein complex 3 beta-1 large chain; PE; HPS; ADTB3;
Gene ID 8546
mRNA Refseq NM_003664
Protein Refseq NP_003655
MIM 603401
UniProt ID O00203

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AP3B1 Products

Required fields are marked with *

My Review for All AP3B1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon