Recombinant Human ARG1 protein, His-tagged
Cat.No. : | ARG1-4654H |
Product Overview : | Recombinant Human ARG1 protein(P05089)(1-322 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-322 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 36.8 kDa |
AASequence : | RAETDSEGQTTGELYQRWERYGWECQNTLEATEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQKLILERLQ |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | ARG1 arginase, liver [ Homo sapiens ] |
Official Symbol | ARG1 |
Synonyms | ARG1; arginase, liver; arginase-1; type I arginase; liver-type arginase; |
Gene ID | 383 |
mRNA Refseq | NM_000045 |
Protein Refseq | NP_000036 |
MIM | 608313 |
UniProt ID | P05089 |
◆ Recombinant Proteins | ||
ARG1-2489H | Recombinant Human Arginase, Liver, His-tagged | +Inquiry |
ARG1-1185HF | Recombinant Full Length Human ARG1 Protein, GST-tagged | +Inquiry |
ARG1-371H | Recombinant Human ARG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARG1-250HFL | Active Recombinant Full Length Human ARG1 Protein, C-Flag-tagged | +Inquiry |
ARG1-0630H | Recombinant Human ARG1 Protein (Met1-Lys322), N-His-tagged | +Inquiry |
◆ Native Proteins | ||
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
Arg1-150R | Active Native Rat Arginase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARG1-1869HCL | Recombinant Human ARG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARG1 Products
Required fields are marked with *
My Review for All ARG1 Products
Required fields are marked with *