Recombinant Human ARG1 protein, His-tagged

Cat.No. : ARG1-4654H
Product Overview : Recombinant Human ARG1 protein(P05089)(1-322 aa), fused with N-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-322 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 36.8 kDa
AASequence : RAETDSEGQTTGELYQRWERYGWECQNTLEATEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQKLILERLQ
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name ARG1 arginase, liver [ Homo sapiens ]
Official Symbol ARG1
Synonyms ARG1; arginase, liver; arginase-1; type I arginase; liver-type arginase;
Gene ID 383
mRNA Refseq NM_000045
Protein Refseq NP_000036
MIM 608313
UniProt ID P05089

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARG1 Products

Required fields are marked with *

My Review for All ARG1 Products

Required fields are marked with *

0
cart-icon