Recombinant Human BIRC3 protein, His-tagged

• Cat.No.: BIRC3-2540H
• Product Overview: Recombinant Human BIRC3 protein(78-169 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 78-169 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: RGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNE
• Purity: 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: BIRC3 baculoviral IAP repeat containing 3 [ Homo sapiens ]
• Official Symbol: BIRC3
• Synonyms: BIRC3; baculoviral IAP repeat containing 3; API2, baculoviral IAP repeat containing 3; baculoviral IAP repeat-containing protein 3; apoptosis inhibitor 2; c IAP2; cIAP2; hiap 1; inhibitor of apoptosis protein 1; MALT2; mammalian IAP homolog C; MIHC; RNF49; TNFR2 TRAF signaling complex protein; IAP-1; IAP homolog C; RING finger protein 49; baculoviral IAP repeat-containing 3; TNFR2-TRAF signaling complex protein; TNFR2-TRAF-signaling complex protein 1; AIP1; API2; CIAP2; HAIP1; HIAP1; c-IAP2
• Gene ID: 330
• mRNA Refseq: NM_001165
• Protein Refseq: NP_001156
• MIM: 601721
• UniProt ID: Q13489