Recombinant Human BIRC3 protein, His-tagged

Cat.No. : BIRC3-2540H
Product Overview : Recombinant Human BIRC3 protein(78-169 aa), fused to His tag, was expressed in E. coli.
Availability November 29, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 78-169 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : RGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNE
Purity : 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name BIRC3 baculoviral IAP repeat containing 3 [ Homo sapiens ]
Official Symbol BIRC3
Synonyms BIRC3; baculoviral IAP repeat containing 3; API2, baculoviral IAP repeat containing 3; baculoviral IAP repeat-containing protein 3; apoptosis inhibitor 2; c IAP2; cIAP2; hiap 1; inhibitor of apoptosis protein 1; MALT2; mammalian IAP homolog C; MIHC; RNF49; TNFR2 TRAF signaling complex protein; IAP-1; IAP homolog C; RING finger protein 49; baculoviral IAP repeat-containing 3; TNFR2-TRAF signaling complex protein; TNFR2-TRAF-signaling complex protein 1; AIP1; API2; CIAP2; HAIP1; HIAP1; c-IAP2;
Gene ID 330
mRNA Refseq NM_001165
Protein Refseq NP_001156
MIM 601721
UniProt ID Q13489

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BIRC3 Products

Required fields are marked with *

My Review for All BIRC3 Products

Required fields are marked with *

0
cart-icon
0
compare icon