Recombinant Human CCL20 Protein, GST-Tagged
| Cat.No. : | CCL20-0624H |
| Product Overview : | Human CCL20 full-length ORF (AAH20698, 27 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene displays chemotactic activity for lymphocytes and can repress proliferation of myeloid progenitors. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014] |
| Molecular Mass : | 33.33 kDa |
| AA Sequence : | SNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCL20 chemokine (C-C motif) ligand 20 [ Homo sapiens ] |
| Official Symbol | CCL20 |
| Synonyms | CCL20; chemokine (C-C motif) ligand 20; SCYA20, small inducible cytokine subfamily A (Cys Cys), member 20; C-C motif chemokine 20; CKb4; exodus 1; LARC; MIP 3a; ST38; exodus-1; MIP-3-alpha; CC chemokine LARC; beta chemokine exodus-1; beta-chemokine exodus-1; small-inducible cytokine A20; macrophage inflammatory protein 3 alpha; liver and activation-regulated chemokine; small inducible cytokine subfamily A (Cys-Cys), member 20; MIP3A; MIP-3a; SCYA20; |
| Gene ID | 6364 |
| mRNA Refseq | NM_001130046 |
| Protein Refseq | NP_001123518 |
| MIM | 601960 |
| UniProt ID | P78556 |
| ◆ Recombinant Proteins | ||
| CCL20-3700H | Recombinant Human CCL20 protein, rFc-tagged | +Inquiry |
| CCL20-2729H | Recombinant Human CCL20 Protein (Ser27-Met96), His tagged | +Inquiry |
| CCL20-793M | Recombinant Mouse CCL20 Protein (Ala28-Met97) | +Inquiry |
| CCL20-3403M | Recombinant Mouse CCL20 protein(Ala28-Met97) | +Inquiry |
| CCL20-0624H | Recombinant Human CCL20 Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL20-447MCL | Recombinant Mouse CCL20 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL20 Products
Required fields are marked with *
My Review for All CCL20 Products
Required fields are marked with *
