Recombinant Human CD4 protein, GST-tagged
Cat.No. : | CD4-10954H |
Product Overview : | Recombinant Human CD4 protein(419-458 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | October 08, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 419-458 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | CVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI |
Gene Name | CD4 CD4 molecule [ Homo sapiens ] |
Official Symbol | CD4 |
Synonyms | CD4; CD4 molecule; CD4 antigen (p55) , T cell surface glycoprotein CD4; T-cell surface glycoprotein CD4; CD4 receptor; CD4 antigen (p55); T-cell surface antigen T4/Leu-3; CD4mut; |
Gene ID | 920 |
mRNA Refseq | NM_000616 |
Protein Refseq | NP_000607 |
MIM | 186940 |
UniProt ID | P01730 |
◆ Recombinant Proteins | ||
CD4-2172H | Active Recombinant Human CD4 protein, His-tagged | +Inquiry |
CD4-24H | Recombinant Human CD4 Protein, His & Avi-tagged | +Inquiry |
CD4-1561R | Recombinant Rabbit CD4 protein, His & GST-tagged | +Inquiry |
CD4-3F | Recombinant Feline CD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cd4-1560M | Recombinant Mouse Cd4 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CD4-58H | Active Recombinant Human CD4 Protein, His-tagged | +Inquiry |
CD4-19R | Active Recombinant Rhesus Macaque CD4 Homodimer Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD4-1865FCL | Recombinant Ferret CD4 cell lysate | +Inquiry |
CD4-947CCL | Recombinant Cynomolgus CD4 cell lysate | +Inquiry |
CD4-1905HCL | Recombinant Human CD4 cell lysate | +Inquiry |
CD4-2580MCL | Recombinant Mouse CD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD4 Products
Required fields are marked with *
My Review for All CD4 Products
Required fields are marked with *